PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019449m
Common NameCARUB_v10019449mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 683aa    MW: 75115 Da    PI: 5.1105
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019449mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.51.2e-12221268249
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                       + kr  r+++NRe+A  sRqRK+ ++eeLe+kvk + +   +L +++
  Carubv10019449m 221 DDQKRNVRLIRNRESAHLSRQRKRHYVEELEDKVKIMHSTICDLNSKM 268
                      678********************************9988777777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-11220284IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.048222285IPR004827Basic-leucine zipper domain
PfamPF001702.6E-11223282IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.7E-11224282No hitNo description
Gene3DG3DSA:1.20.5.1707.2E-14224283No hitNo description
CDDcd147043.72E-16225275No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MAEPPLEELP DTSLTFSSIA IPPLSVVDFC NSTSDRQALL GNSISDLIEN DGDGDFDFTF  60
ADSIGDLYFP SENESFFTPL DATNLELFRG FTPASGISGE DDADKNDNGV LISTSASCDQ  120
ESPKDSDCSD TTTHSLSSST PELVNYVSHI LEATNASSSL GSAQMVIDQK LKVEEEATTY  180
KTSIPKRRKE IDEEDTSNES WNNKYRRMDR DGFAGIGVAE DDQKRNVRLI RNRESAHLSR  240
QRKRHYVEEL EDKVKIMHST ICDLNSKMSF FMAENVTLRH QVSSGSNIYL PLQPRPGIYS  300
VPYPCLPYPA YMVKPQGSQV ALLPIPRLKP QQSVAKVKKF KKVASFSVLG ILFCLFLFGA  360
LAPIVNISYK SNYVTDWVYD QSRGRVLDVN GYLDVSVNSN RAHCGRDSDQ EMGRNVSATE  420
TSGPPRNSSE PLVASLFVPR NDKLVKIDGN LIIHSITESE KSMATETKNE GGKCDESTTN  480
KGDFHALPLP DSTKTDDMSK NIYSKKRKAL SSSGYNDASE DQLKSTTTAN GKMQQWFREG  540
VAGPMFSSGM CTSVFQFDVS TTSGAIIPAS PPIQQSEHTT DTHKGKQNRR ILRGGLPVSD  600
FNLTKEHNSS SNKTLQDTKP STSMIVSVLV DPREGGEGDI DGMMGVTKSL SRVFIVLLVD  660
DVKYVTYSCV LPQPEVPHLM TT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in stress responses. {ECO:0000250|UniProtKB:O22208}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10019449m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006290448.10.0bZIP transcription factor 49 isoform X1
SwissprotQ9LXX40.0BZP49_ARATH; bZIP transcription factor 49
TrEMBLR0FMV20.0R0FMV2_9BRAS; Uncharacterized protein
STRINGXP_006290448.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16991911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56660.10.0basic region/leucine zipper motif protein 49
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]