PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019243m
Common NameCARUB_v10019243mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 338aa    MW: 38248.8 Da    PI: 7.5546
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019243mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.28.3e-14255305555
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +r+rr++kNRe+A rsR+R++a++ eLe +  +L++eN++Lkk++e  +k+
  Carubv10019243m 255 RRQRRMIKNRESAARSRARRQAYTVELELELNNLTEENTKLKKTVEDNEKK 305
                      79*****************************************99987776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.4E-9248316IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.921253305IPR004827Basic-leucine zipper domain
PfamPF001701.2E-11255306IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.19E-9255301No hitNo description
Gene3DG3DSA:1.20.5.1706.5E-13255306No hitNo description
PROSITE patternPS000360258273IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MSAVFESETS TFHVYNHELP QAFMQEPVEE APVGRQNSIL SLTLDEIQMK SGKSFGAMNM  60
DEFLANLWTT VEENDNNNGG GSVVHHEGEK PTVLPRQGSL SLPVPLCKKT VDEVWLEIQN  120
GVQQHPPSSA SRQNSDEDIR RQQTLGEITL EDFLVKAGVV QEPLKTTMRM SSSDFGYNNN  180
PEFGSGVGLQ CQNQNNFGDN RSVYSENRQY YPVLGDSASC MTGNGRGNNQ YMTGVDSFRI  240
KKRILDGPPE ILMERRQRRM IKNRESAARS RARRQAYTVE LELELNNLTE ENTKLKKTVE  300
DNEKKRRQEI INRSKQVTKE KSGDKLRKIR RMASAGW*
Functional Description ? help Back to Top
Source Description
UniProtCould participate in abscisic acid-regulated gene expression during seed development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10019243m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292966.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 1
SwissprotQ8RYD60.0AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLR0H9240.0R0H924_9BRAS; Uncharacterized protein
STRINGXP_006292966.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.10.0bZIP family protein