PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10018947m
Common NameCARUB_v10018947mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 170aa    MW: 19790.9 Da    PI: 6.273
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10018947mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1408.5e-1377127555
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +++rr+ +NRe+ArrsR RK+  ++eL   v  L +eN  L+++l++ +++
  Carubv10018947m  77 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSET 127
                      79********************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.0E-1473137IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.58875126IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-1077149No hitNo description
SuperFamilySSF579595.47E-1277126No hitNo description
PfamPF001701.2E-1077127IPR004827Basic-leucine zipper domain
CDDcd147021.69E-1778126No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MIPAEITGYF QYLSPEYNVI NMPTSPTSSL NYLNDMIINN NNSNYSSSSN SQELMISNNN  60
SASDEDHHQS IIILDERKQR RMLSNRESAR RSRMRKQRHL DELWSQVIRL RNENNCLIDK  120
LNRVSETQDC VLKENSKLKE EASDLRQLVC ELKSNKNNNN SFAREFEDN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18996RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00262DAPTransfer from AT2G04038Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10018947m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935450.0AB493545.1 Arabidopsis thaliana At2g04038 gene for hypothetical protein, partial cds, clone: RAAt2g04038.
GenBankAC0071780.0AC007178.6 Arabidopsis thaliana chromosome 2 clone F3L12 map mi320, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292701.11e-119basic leucine zipper 43
TrEMBLR0H8E41e-117R0H8E4_9BRAS; Uncharacterized protein
STRINGXP_006292701.11e-118(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.16e-89basic leucine-zipper 48