PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10018770m
Common NameCARUB_v10018770mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 277aa    MW: 29970.7 Da    PI: 9.3879
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10018770mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.29.6e-15231273547
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                      +r++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++L+ 
  Carubv10018770m 231 RRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLRR 273
                      79***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-13224274No hitNo description
SMARTSM003382.6E-7227274IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.427229274IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-9231274No hitNo description
CDDcd147071.10E-22231276No hitNo description
PfamPF001702.4E-12231273IPR004827Basic-leucine zipper domain
PROSITE patternPS000360234249IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MDSQRGIVEE AKSQSLNRQG SLYSLTLDEV QNHLGSSGKA LGSMNLDELL KSVCSVEANQ  60
PSSMAMNGAA TAQEGLSRQG SLTLPRDLSK KTVDEVWKDI QQNKNGGTAH ERRDKQPTLG  120
EMTLEDLLLK AGVVTETIPG SNHDAPGGPA GGGGSAGSGA GLGQNISPVG PWVQYHQLPS  180
MPQPQAFMPY PVSDMQTMVS QSSMMGGLSD TQTPGRKRVA SGEVVEKTVE RRQKRMIKNR  240
ESAARSRARK QAYTHELEIK VSRLEEENER LRRQKF*
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10018770m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0171620.0AB017162.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 3 (AREB3), complete cds.
GenBankAY0624480.0AY062448.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850; T8M16_180) mRNA, complete cds.
GenBankAY0816700.0AY081670.1 Arabidopsis thaliana promoter-binding factor-like protein (At3g56850) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023638030.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-178AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLR0FMQ70.0R0FMQ7_9BRAS; Uncharacterized protein
STRINGXP_006290403.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-170ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  2. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]