PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017446m
Common NameCARUB_v10017440mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 377aa    MW: 42911.4 Da    PI: 8.1548
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017446mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.21.4e-201053245
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     + en+  rq tf+kR++gilKKA+ELS+LCd+++ +++fs+tgk
  Carubv10017446m 10 KLENTNGRQNTFAKRKHGILKKANELSILCDIDIVLLMFSPTGK 53
                     6799**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.857153IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-25293IPR002100Transcription factor, MADS-box
CDDcd002668.31E-26281No hitNo description
PRINTSPR004044.9E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-171153IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQNT FAKRKHGILK KANELSILCD IDIVLLMFSP TGKAALCCGT  60
RSMEEVIAKF SQVTPQERTK RKFESLENLK KTFQKLDHHV NIREFISSSN STVEDLSTQA  120
RILQARISEI HGRLSYWTEP DKINNIEHLG QLEISIRQSI DQLRAHKEHF GQQQHAMQIE  180
NANFVKDWST CSLQDGIQIP LEQQLQSMSW ILNSNPTNIV TDEHKLIPQR EVECSASSSF  240
GSYPGYFGTG KSPEITISGQ ETSFLDELNT GQMKPQLSSH QQFANNITAY NPNLQNDLNH  300
HQTLPPPQVY IPMNQREYHM NEYFEAPPPG SSAYNNNTNQ TRFGSSSSSL PCSLSMFDEY  360
LFSQVNKTKL VLRMRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-12191190MEF2 CHIMERA
6byy_B1e-12191190MEF2 CHIMERA
6byy_C1e-12191190MEF2 CHIMERA
6byy_D1e-12191190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10017446m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4464590.0DQ446459.1 Arabidopsis thaliana clone pENTR221-At2g03060 MADS-box family protein (At2g03060) mRNA, complete cds.
GenBankDQ6529540.0DQ652954.1 Arabidopsis thaliana clone 0000017365_0000012150 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023637840.10.0agamous-like MADS-box protein AGL30 isoform X2
SwissprotQ1PFA40.0AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLR0HJZ30.0R0HJZ3_9BRAS; Uncharacterized protein
STRINGXP_006291306.10.0(Capsella rubella)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.20.0AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]