PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017372m
Common NameCARUB_v10017372mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 404aa    MW: 44203.7 Da    PI: 6.5197
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017372mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.71.4e-14228282357
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                      ++kr+rr+ +NRe+ArrsR+RK++++ e  + v +L ae ++L ++l+ ++ +++
  Carubv10017372m 228 DVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLLNRLSDMNHKYD 282
                      68******************************************77776666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.5E-16226290IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.3E-10227280No hitNo description
PROSITE profilePS5021710.668228282IPR004827Basic-leucine zipper domain
PfamPF001707.4E-12229282IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.22E-10230280No hitNo description
PROSITE patternPS000360233248IPR004827Basic-leucine zipper domain
PfamPF124981.6E-12297343IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MHIVFSVDDL TESFWPVPAP APSPGSTPLP APPQNMTDGM TRSQSEWAFH RLLNELSGSD  60
SSATTNTIER SPPPVQSLPR VEETVEETED VVEIQKPQQS HHRLPADDQG NRNRAPSSDP  120
LDSSAGVDPN QYHAILKSKL ELACAAVARR VGTVKPEDSS ASASNQKQAQ GSTVAQTSPG  180
ASSVKFSSST STQKKPDVPA RQTTSISSRD DSDDDDLDGD ADNGDPTDVK RARRMLSNRE  240
SARRSRRRKQ EQMNEFDTQV GQLRAEHSTL LNRLSDMNHK YDAAAVDNRI LRADIETLRT  300
KVKMAEETVK RVTGVNPLHW ARPNMGIPFN NTPSAPTRIP PNANHIVKPG IPSTTTTSAG  360
LAPNQRAEAA NFLPEQVNRD GMQNPFAPDS NMYETLPHWN HKH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242249RRSRRRKQ
2244249SRRRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'-ACGT-3' box, especially present in G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:19261733, ECO:0000269|PubMed:19531597}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10017372m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0575090.0AY057509.1 Arabidopsis thaliana bZIP transcription factor-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291240.10.0basic leucine zipper 25 isoform X1
SwissprotQ9M1G60.0BZP25_ARATH; Basic leucine zipper 25
TrEMBLR0HJT90.0R0HJT9_9BRAS; Uncharacterized protein
STRINGXP_006291240.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58482645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.10.0basic leucine zipper 25
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  3. Jain P, et al.
    A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
    Sci Rep, 2017. 7(1): p. 14343
    [PMID:29084982]
  4. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]