PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10015986m
Common NameCARUB_v10015986mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 403aa    MW: 44844.5 Da    PI: 9.6683
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10015986mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.21.9e-223887251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     +++++s + +++ kR+++++KKA ELSvLC++ev+vi ++ +g+l+++++
  Carubv10015986m 38 SSSSSSSKATSLKKRQETVFKKAGELSVLCGIEVCVICYGADGELKTWPK 87
                     78999*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-61488IPR002100Transcription factor, MADS-box
PfamPF003193.9E-144185IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-1741120IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.5634189IPR002100Transcription factor, MADS-box
CDDcd002663.21E-1652113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MVSFSSCSPS YSSSAKKKTT MSIPQIQQTL FKKPSYASSS SSSSKATSLK KRQETVFKKA  60
GELSVLCGIE VCVICYGADG ELKTWPKERE KVKAIAQRYA ALSETKRRKG SVDLHEFLEK  120
INNDDSKKKT KKKKVRRVPK VKYPVWDPRF DNYSVEQLTG LIQSLERNLT RIQHRVRAVV  180
EGQGQRKIQY LSMANQGPML PSTMNQYLQQ QPNQVSMFLF NHGNGNISQI PVSASALNQG  240
QSLAPVPPEL MIYPNLDVGN YSGSLGVQGT GISGFQNMNM NMLAYNNINS FDGFSKQIDQ  300
NSKVESYSSL LGAGIDELED TNMYNHNNVN TGDYSGLLGT QGIVTNELNM SMHDYNNNNS  360
VNANGLSHQF GQFQTQQQQG AFNWDQPGNN FRPLYDLPQP LL*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10015986m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299790.20.0agamous-like MADS-box protein AGL103
SwissprotQ9LSB21e-173AG103_ARATH; Agamous-like MADS-box protein AGL103
TrEMBLR0I8550.0R0I855_9BRAS; Uncharacterized protein
STRINGXP_006299790.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.11e-149AGAMOUS-like 103
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]