PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10015981m
Common NameCARUB_v10015981mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 334aa    MW: 38261.7 Da    PI: 6.2911
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10015981mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.15.5e-141151343
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                     ien   r++ + +R++g+ KK +EL +LC ++v++i+fs++
  Carubv10015981m 11 IENANARTICLKRRKEGLVKKLKELTILCSINVCMIMFSPN 51
                     9**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-18160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.273151IPR002100Transcription factor, MADS-box
CDDcd002661.07E-23285No hitNo description
SuperFamilySSF554554.32E-20296IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-5323IPR002100Transcription factor, MADS-box
PfamPF003198.8E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MTRKAIKLAW IENANARTIC LKRRKEGLVK KLKELTILCS INVCMIMFSP NEAEPMVWPS  60
AEKARGLLAD FNALSEVEKT KKQTSLESFM KEKIKKVHEQ IMKTRKKNIS YAIDHLMVKL  120
HRGGGIHDLN LSEIYDLISF LRDNIILYRK MLGFAQYPLL QDPPVQPQFE EFTTTTTTND  180
VFVRSGQEDE RAWKTDEAEN MISIGNAIKE NQSHYLIDQW FFPSPQQPNP RIHQQIQMGA  240
VCYNNSISET ANMEMEPVGT SMITFHGLFG SVSQPLQNHN VDDNAAVAIS QPIQNPFNFM  300
SHEELPPPNE EDNDDVTLFD MNKVWPHINN NHM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10015981m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020889440.11e-131MADS-box protein SVP-like
TrEMBLR0I8510.0R0I851_9BRAS; Uncharacterized protein
STRINGXP_006299785.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.12e-84AGAMOUS-like 48