PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10015868m
Common NameCARUB_v10015868mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family CPP
Protein Properties Length: 629aa    MW: 68684.1 Da    PI: 7.6261
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10015868mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.86.9e-16343381240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk+
  Carubv10015868m 343 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKS 381
                      689**********************************97 PP

2TCR51.22.4e-16428466139
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Carubv10015868m 428 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 466
                      589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.7E-19342383IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.458343468IPR005172CRC domain
PfamPF036381.4E-11345380IPR005172CRC domain
SMARTSM011143.7E-17428469IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.7E-12430466IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MDTPQKSITQ IGTPVSKLKA EDSPVFNYIC SLSPIKSTKS IPITHTLSSL NFTSPPSVFT  60
SPHAVSHKES RFRSQVNSSD HSKDGVGSNE EAGSIGEKGK EEALTEIEQS QIPKNECNTP  120
RVANDVRDNG CCEDGGMNLV KMCDNVKPKS DTPDWGTLIS ATTELIYNLT SESEAYSCLL  180
KRTSNSGEHV RGGTMSTLES VSKTNVANNE NESFDDLSIS HRGVRRRCLD FEIPRNSQQT  240
LGESSSSCVV PSIGLHLNAI PMSSKDNNVV NEYSFSGNIK VGSQSFTTSD LHSKHHIVRE  300
NEIGKDAGQA LEEFPKSSAL EGLPISPKKK RRKSEQSGEG ESSCKRCNCK KSKCLKLYCE  360
CFAAGVYCIE PCSCIDCFNK SIHEDVVLAT RKQIESRNPL AFAPKVIRSS DSIIEVGDDT  420
SKTPASARHK RGCNCKKSNC LKKYCECYQG GVGCSINCRC EGCKNAFGRK DGSLFEQDEE  480
NEVSGKIVTT KTQSNVELFN PLPSTPMPLR QPLAQLPIPS NNRLLPSASH FHHGASGSSS  540
SGIYNIRKPD MSLLSHSRIE AITEDIDDDM SENLIQSPLN NMKAVVSPNS KRVSLQHLDS  600
SETTPWRRNG GRKLILSIPT FPSLTPHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1634546512120Protein lin-54 homolog
5fd3_B1e-1634546512120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1327331KKKRR
2327332KKKRRK
3328332KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10015868m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299680.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLR0I7X40.0R0I7X4_9BRAS; Uncharacterized protein
STRINGXP_006299680.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]