PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10015292m
Common NameCARUB_v10015292mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 172aa    MW: 18871.7 Da    PI: 5.2132
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10015292mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.52.4e-123288561
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                     ++ +r+ +NRe+ArrsR RK++ ++ L+  + +L++ N++  + l   ++++ k ++
  Carubv10015292m 32 RKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSNDNRQILNSLTVTSQLYMKIQA 88
                     57899*********************************8877777666666666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-162892IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.8E-102977No hitNo description
PROSITE profilePS5021710.1973093IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.04E-123283No hitNo description
PfamPF001701.3E-93283IPR004827Basic-leucine zipper domain
CDDcd147028.71E-223384No hitNo description
PROSITE patternPS0003603550IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MASSSSTYRS SSSSDGGNNN PSSDSVVTVD ERKRKRMLSN RESARRSRMR KQKHVDDLTA  60
QINQLSNDNR QILNSLTVTS QLYMKIQAEN SVLTAQMTEL STRLESLNEI VDLVQSNGAG  120
FGGGDQIDGC GFDDRTVGID GYYDDMMSGV NHWGGSVYSN HPIMANDINM Y*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13152RKRKRMLSNRESARRSRMRKQK
24451RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to specific DNA sequences in target gene promoters. BZIP2-BZIP63-KIN10 complex binds to the ETFQO promoter to up-regulate its transcription (PubMed:29348240). {ECO:0000250|UniProtKB:O65683, ECO:0000269|PubMed:29348240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00267DAPTransfer from AT2G18160Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10015292m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0072120.0AC007212.7 Arabidopsis thaliana chromosome 2 clone F8D23 map PhyB, complete sequence.
GenBankAK2302440.0AK230244.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL23-13-A15.
GenBankAY0372160.0AY037216.1 Arabidopsis thaliana At2g18160/F8D23.6 mRNA, complete cds.
GenBankAY1335450.0AY133545.1 Arabidopsis thaliana At2g18160/F8D23.6 mRNA, complete cds.
GenBankBT0007000.0BT000700.1 Arabidopsis thaliana clone RAFL08-13-K01 (R11176) putative bZIP transcription factor (At2g18160) mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299149.11e-123bZIP transcription factor 2
SwissprotQ9SI151e-103BZIP2_ARATH; bZIP transcription factor 2
TrEMBLR0G8U91e-122R0G8U9_9BRAS; Uncharacterized protein
STRINGCagra.0027s0007.1.p1e-122(Capsella grandiflora)
STRINGXP_006299149.11e-122(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.17e-82basic leucine-zipper 2
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  2. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]