PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10015167m
Common NameCARUB_v10015167mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 246aa    MW: 28417 Da    PI: 5.7369
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10015167mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.21.6e-161053245
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                      i+n+s r+ tf kR++g +KK +EL vLC++e++ +++ +++ 
  Carubv10015167m 10 YIDNDSMRKATFNKRKKGFMKKIHELTVLCGIEACAVVYNPSNS 53
                     59************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-22160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.661152IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-24294IPR002100Transcription factor, MADS-box
CDDcd002663.62E-32285No hitNo description
PRINTSPR004042.3E-10323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-161152IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MTRKKLNLSY IDNDSMRKAT FNKRKKGFMK KIHELTVLCG IEACAVVYNP SNSTPEAWPS  60
NSGVKNVVEK FEMLTEVEQE KRMVNHEGFL KQNISKAVAN NNKKMKDNGE RLMKEVMFQL  120
LRGKRDEFKL TNKNREDLCN YIDQYLRELH HHKNETLKRS SEATNAMAPP SMVEPIISSS  180
EIPEEVNTLT GAAADQQEYY PVGLSDQYQY QQQYEYPIEP QDLIDNPSQN QDQQEEWLIS  240
NDGPF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154159ETLKRS
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10015167m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023642507.11e-171agamous-like MADS-box protein AGL80
TrEMBLR0I6920.0R0I692_9BRAS; Uncharacterized protein
STRINGXP_006299030.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.37e-90M-type_MADS family protein