PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10014761m
Common NameCARUB_v10014761mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 177aa    MW: 20276.8 Da    PI: 6.8006
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10014761mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.52e-191157349
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     ++++  +qvtfskRr g++KKA+EL +LC+aev +++fs+ +k y +
  Carubv10014761m 11 VQDTNTKQVTFSKRRLGLFKKASELATLCNAEVGIVVFSPGNKPYSF 57
                     5678889*********************************9998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.796161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.06E-25171IPR002100Transcription factor, MADS-box
SMARTSM004326.7E-31160IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-18323IPR002100Transcription factor, MADS-box
PfamPF003195.8E-231257IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRRKIKMEE VQDTNTKQVT FSKRRLGLFK KASELATLCN AEVGIVVFSP GNKPYSFGKP  60
NFDLIAERFK SEFEETDSFE TSSGYRRGSR ARQEKKICKR LNSVVEDAEA EKKHGEDLHN  120
WLESAEEDRF NKPIDEFTLE ELKEFEAKMK RLRGGIQSNI DHMQASSSLL FLSNDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-15188192Myocyte-specific enhancer factor 2B
1tqe_Q2e-15188192Myocyte-specific enhancer factor 2B
1tqe_R2e-15188192Myocyte-specific enhancer factor 2B
1tqe_S2e-15188192Myocyte-specific enhancer factor 2B
6byy_A1e-15181187MEF2 CHIMERA
6byy_B1e-15181187MEF2 CHIMERA
6byy_C1e-15181187MEF2 CHIMERA
6byy_D1e-15181187MEF2 CHIMERA
6c9l_A2e-15188192Myocyte-specific enhancer factor 2B
6c9l_B2e-15188192Myocyte-specific enhancer factor 2B
6c9l_C2e-15188192Myocyte-specific enhancer factor 2B
6c9l_D2e-15188192Myocyte-specific enhancer factor 2B
6c9l_E2e-15188192Myocyte-specific enhancer factor 2B
6c9l_F2e-15188192Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10014761m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0361061e-142AC036106.6 Arabidopsis thaliana chromosome 3 BAC T8E24 genomic sequence, complete sequence.
GenBankCP0026861e-142CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankDQ0566341e-142DQ056634.1 Arabidopsis thaliana MADS-box family protein (At3g66656) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296625.11e-127agamous-like MADS-box protein AGL29
SwissprotO647038e-61AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLR0HZP11e-126R0HZP1_9BRAS; Uncharacterized protein
STRINGCagra.0133s0015.1.p1e-127(Capsella grandiflora)
STRINGXP_006296625.11e-127(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G66656.14e-95AGAMOUS-like 91
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]