PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10014636m
Common NameCARUB_v10014636mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family SBP
Protein Properties Length: 209aa    MW: 24144.2 Da    PI: 10.2514
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10014636mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.51.5e-4190165277
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      Cqv++C+a+l+eak+y+rrh+vCevh+ka++++v+g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk +
  Carubv10014636m  90 CQVDRCTANLTEAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKIS 165
                      *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.57387164IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.7E-3287151IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-3889168IPR004333Transcription factor, SBP-box
PfamPF031101.3E-3190163IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
PIPQHYIVLT RTLPPSSQGY NFKLYQKMEG QRTQRRGYLK SKATVSNLDE EEMENGMDGE  60
AEDGGEEDQK KRMMERVRGP STDRVPSRLC QVDRCTANLT EAKQYYRRHR VCEVHAKASA  120
ATVTGVRQRF CQQCSRFHEL PEFDEAKRSC RRRLAGHNER RRKISGDIYG EGSGRRGFSG  180
QLIQTQEKNR VEMKLPMTNS SFKRPQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-4088163984squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186110.0AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19.
GenBankAJ2429600.0AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene).
GenBankAJ0116100.0AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298553.11e-155hypothetical protein CARUB_v10014636mg, partial
SwissprotQ9S7581e-111SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLR0G7J61e-155R0G7J6_9BRAS; Uncharacterized protein (Fragment)
STRINGAT3G15270.11e-109(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-108squamosa promoter binding protein-like 5