PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013903m
Common NameCARUB_v10013903mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 393aa    MW: 43448.9 Da    PI: 6.8211
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013903mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573122.22.6e-38144236298
           DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                      +fqrlwseeDei+lLqG+idfka++g+sp+dd+++f++  kk+isf+vsk+q+++Kir+L++K+++k +k     +++fsk+hd+k++ l++ i
  Carubv10013903m 144 RFQRLWSEEDEISLLQGMIDFKAEKGTSPYDDMNGFFDEYKKCISFNVSKTQFSDKIRSLRNKYRGKDNK----GNKTFSKSHDEKCLRLANCI 233
                      79*******************************************************************9....5569**************** PP

           DUF573  96 Wgs 98 
                      Wgs
  Carubv10013903m 234 WGS 236
                      *95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.3E-30145235IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010629Biological Processnegative regulation of gene expression
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005623Cellular Componentcell
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MPKKLLNPLE DPPTASSSED EEVEHSSSED EEQISNPSSE EDEPKDPATE TLKTPSPAKP  60
AVSLSSGSET GSDSESEPAE KTVAVTAAKS KKKKSEVSTP VKSGKKRGSE ATTSTNTKEH  120
AKRAKKVSGD DEKRNVVQVD KKPRFQRLWS EEDEISLLQG MIDFKAEKGT SPYDDMNGFF  180
DEYKKCISFN VSKTQFSDKI RSLRNKYRGK DNKGNKTFSK SHDEKCLRLA NCIWGSDGLA  240
LNSAVKSPVK SKKVDPKKKK KKLESEVEDE DKEVLGSDAM ALESVVVKAN GNGKKVESLK  300
PEGEKVDQDN EVMILDGDSE SSNLFENSFL IRSIVSLGLD EYSVKQKWSK MPIETKKRIE  360
EKLKMVKAME YKLVVQKADV VKQVASVINE AV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1255262PKKKKKKL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00420DAPTransfer from AT4G00250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297863.10.0hypothetical protein CARUB_v10013903mg
TrEMBLR0G5T30.0R0G5T3_9BRAS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00238.12e-55DNA-binding storekeeper protein-related transcriptional regulator