PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013361m
Common NameCARUB_v10013361mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family CPP
Protein Properties Length: 563aa    MW: 60675.2 Da    PI: 8.7277
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013361mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14100140142
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                      ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  Carubv10013361m 100 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVEN 140
                      589**************************.********9875 PP

2TCR50.25.1e-16186224240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      + kgC+Ckks ClkkYCeCf+a+ +Cse+CkC dCkN e
  Carubv10013361m 186 HYKGCHCKKSGCLKKYCECFQANIFCSENCKCLDCKNFE 224
                      789**********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-16100140IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.157101225IPR005172CRC domain
PfamPF036387.0E-11102137IPR005172CRC domain
SMARTSM011142.7E-19185226IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.5E-13188223IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MGEGEGEGDK LPPEKEEITQ DSKKSARQLD FTDVALPQSN QAPVASMAVT ATRPVTSQAR  60
PVIPIPPPQG FLHVPIRHPK PESPKSKPRP VGETRDGTPQ KKKQCNCKHS RCLKLYCECF  120
ASGTYCDGCN CVNCFNNVEN EPARREAVNS TLERNPNAFK PKIASSPHGR RDNWEVVGEV  180
VTSGKHYKGC HCKKSGCLKK YCECFQANIF CSENCKCLDC KNFEGSEERQ SLFHSDHSHN  240
VAYLQHVNAA ITGAIGSSGF ASAPAPKRRK GQEISFNQGT KDSSTHRLGQ ANNGRTTPST  300
TGSRTGGNTS LGPSKVVYRS LLADIIQPKN VQALCSTLVA VAGEVAKAFT KKRLADQKET  360
SMSSSVQDQG QGNNKGTEVE KSVSANQAEK SGLEDTNFGS KGRSLSPETL SLMCDERDTM  420
LMVAASPNCS VKPTSQLPNG QDQVYADQEK VVLIKFRDYL NRIISQGGIK ESNCSLSRTN  480
LDTTPVHTAV KIQPVVQQGP VANGFSQTIK QPSHLTTTTP TPTPTPTPTP TPAPTPTPAP  540
APTTSSQTHL QKTPSLFETK DL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-35922341132Protein lin-54 homolog
5fd3_B6e-35922341132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10013361m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935560.0AB493556.1 Arabidopsis thaliana At2g20110 mRNA for hypothetical protein, partial cds, clone: RAAt2g20110.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297342.10.0protein tesmin/TSO1-like CXC 6
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLR0HXL30.0R0HXL3_9BRAS; Uncharacterized protein
STRINGXP_006297342.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein