PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10012479m
Common NameCARUB_v10012479mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 158aa    MW: 18232.9 Da    PI: 8.5853
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10012479mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.34.7e-141564150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     k+i+ +  r vt+skRrn i  K  E+SvLC+a+va + + s+gk y++ 
  Carubv10012479m 15 KKIDRYEDRLVTLSKRRNSIYTKLCEISVLCGANVAFLGYTSSGKPYTFG 64
                     67999999****************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.273767IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-12766IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-17893IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-12929IPR002100Transcription factor, MADS-box
PfamPF003198.0E-141663IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-122944IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-124465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MSFKKTKGKQ KIMIKKIDRY EDRLVTLSKR RNSIYTKLCE ISVLCGANVA FLGYTSSGKP  60
YTFGTSSSSS SLQQSILDAH YKEIVQEFCT SYNNMVELAR ADEMKTMKTV ASVELFSKDT  120
WWKEHLMEKK DQEENKQFLE KFEGLYEKLC DELDARS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10012479m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301316.13e-68agamous-like MADS-box protein AGL29
TrEMBLR0GTY11e-112R0GTY1_9BRAS; Uncharacterized protein
STRINGXP_006306494.11e-113(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46761352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29962.16e-42AGAMOUS-like 64