PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10012265m
Common NameCARUB_v10012265mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 91aa    MW: 10709.5 Da    PI: 10.5219
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10012265mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.36.3e-26959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krie+ ++rqvtf+kRr+ ++KKA+ELSvLCd+   +iifs +++ly+++s
  Carubv10012265m  9 KRIEDRIRRQVTFAKRRKSLMKKAHELSVLCDVHLGLIIFSYSNRLYDFCS 59
                     79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.338161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-30160IPR002100Transcription factor, MADS-box
CDDcd002651.98E-35280No hitNo description
PRINTSPR004044.7E-24323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-26384IPR002100Transcription factor, MADS-box
PfamPF003191.2E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-243859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030308Biological Processnegative regulation of cell growth
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048530Biological Processfruit morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MRKGKVVIKR IEDRIRRQVT FAKRRKSLMK KAHELSVLCD VHLGLIIFSY SNRLYDFCSN  60
TTSMENLIMR YQMEKEAGHT HTSADHSFHP A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-18185183Myocyte-specific enhancer factor 2B
1tqe_Q1e-18185183Myocyte-specific enhancer factor 2B
1tqe_R1e-18185183Myocyte-specific enhancer factor 2B
1tqe_S1e-18185183Myocyte-specific enhancer factor 2B
6c9l_A1e-18185183Myocyte-specific enhancer factor 2B
6c9l_B1e-18185183Myocyte-specific enhancer factor 2B
6c9l_C1e-18185183Myocyte-specific enhancer factor 2B
6c9l_D1e-18185183Myocyte-specific enhancer factor 2B
6c9l_E1e-18185183Myocyte-specific enhancer factor 2B
6c9l_F1e-18185183Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091, ECO:0000269|PubMed:27233529}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10012265m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934893e-77AB493489.1 Arabidopsis thaliana At1g31140 mRNA for hypothetical protein, partial cds, clone: RAAt1g31140.
GenBankAY1412433e-77AY141243.1 Arabidopsis thaliana MADS-box protein AGL63 mRNA, complete cds.
GenBankFR6713673e-77FR671367.1 Arabidopsis thaliana mRNA for putative MADS domain protein AGL63 (GOA), ecotype Col-0.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306362.22e-61agamous-like MADS-box protein AGL63
SwissprotQ9SA072e-45AGL63_ARATH; Agamous-like MADS-box protein AGL63
TrEMBLA0A2H4FR434e-60A0A2H4FR43_9BRAS; MADS-box transcription factor AGL63
TrEMBLR0IL242e-61R0IL24_9BRAS; Uncharacterized protein (Fragment)
STRINGXP_006306362.13e-62(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31140.27e-48GORDITA
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]