PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011711m
Common NameCARUB_v10011711mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 207aa    MW: 23405.1 Da    PI: 9.8492
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011711mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.31.5e-3425116192
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                      aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g ++++ ++l+  k+
  Carubv10011711m  25 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRICEELKLYKS 116
                      7***********************************************************************************99998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.26424124IPR004883Lateral organ boundaries, LOB
PfamPF031958.5E-3225115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MMQRNSNAIT TTNNNISNNP STHQACASCK HQRKKCNNEC ILSPYFPARK TKEFQAVHKV  60
FGVSNVQKMV RTVREEDRTK LSDSLTWEAL WRQKDPVLGS YGEYRRICEE LKLYKSLVHN  120
QPLLGWDNNQ RVYNNNNNKT GLAMNSSGSG VFSGNNNGAG VNGEIVNGGY SSRNLQGGWE  180
NPKHDQRQQC YAVINGFKQQ HYHLPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-1817102388LOB family transfactor Ramosa2.1
5ly0_B3e-1817102388LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10011711m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738650.0AB473865.1 Arabidopsis thaliana ASL32 mRNA for ASYMMETRIC LEAVES2-like 32 protein, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF9P140.0AC025290.3 Sequence of BAC F9P14 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304620.11e-154LOB domain-containing protein 2
SwissprotQ9LNB91e-114LBD2_ARATH; LOB domain-containing protein 2
TrEMBLR0IKK61e-153R0IKK6_9BRAS; Uncharacterized protein
STRINGXP_006304620.11e-154(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.15e-93LOB domain-containing protein 2