PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011611m
Common NameCARUB_v10011611mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 314aa    MW: 35573.4 Da    PI: 7.1073
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011611mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.37.4e-121150342
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     i + ++r+ +f kR+ gi KK  E+ +LCd++++ +i s+
  Carubv10011611m 11 IPDPTRRKASFKKRKRGIQKKLDEITTLCDVKACAVINSP 50
                     66789*******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-11160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.105149IPR002100Transcription factor, MADS-box
CDDcd002661.96E-21379No hitNo description
SuperFamilySSF554557.19E-19794IPR002100Transcription factor, MADS-box
PfamPF003192.2E-111151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSTRPKKLSL IPDPTRRKAS FKKRKRGIQK KLDEITTLCD VKACAVINSP FEKNPVVWPS  60
KEGIKEVVSE FQQVPEYKRY TYMVNLETYL KERIGKATES LRKLREENYE SQLKQIMFDC  120
LIGTMKVQSC NPMGYDNLIG YIDSYLKRIE VSMQLHAENG ESSSLPPPPA SVDGVDPPAV  180
HEHAGPSNEL HGYFPYDNMN LNLSNHEVPV QHQVLTQNQN QQGPVQYNPL INFNDETAHR  240
FSGMSLHQNM SQDPYQGMYQ QSSFMNLLAA LPQQMGYVGE HAHVPYQQQP TIDLAATGHM  300
PVITTTMTNT STPA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11631RKASFKKRKRGIQKKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10011611m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306141.20.0agamous-like MADS-box protein AGL86
TrEMBLR0I9H80.0R0I9H8_9BRAS; Uncharacterized protein (Fragment)
STRINGXP_006306141.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31630.13e-59AGAMOUS-like 86