PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011573m
Common NameCARUB_v10011573mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 277aa    MW: 31067.7 Da    PI: 5.5206
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011573mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_158.21.8e-18193253363
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        +r++r++kNRe+A rsR+RK+a++ eLe+ +++Le+eN++L ke+ee +ke +k  +ev
  Carubv10011573m 193 TAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQLLKEIEETTKERYKKLMEV 253
                      679***************************************************9988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-14189246No hitNo description
SMARTSM003382.9E-15191255IPR004827Basic-leucine zipper domain
PfamPF001701.5E-17192253IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.53193245IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-11195247No hitNo description
CDDcd147074.36E-18195244No hitNo description
PROSITE patternPS000360198213IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MASFKLMSSS NSDLSRRNSS SASSSPSIRS SNHLRPNLHA DQSRISFAYG GGSDYTFASD  60
SKPLDMAIDL GDRNSVNNGK SVDDVWKEIV SGEQRRILMK EEAQEDVTMT LEDFLAKAAM  120
DDDAANIDSD GIDVKIPPER LNNDGSYTFD FPMMSQPQPQ RHSSFQMIEG SMGGGGMRGK  180
RGRVMMEAMD KATAQRQKRM IKNRESAARS RERKQAYQVE LETLAAKLEE ENEQLLKEIE  240
ETTKERYKKL MEVLIPVDEN PRPSSRSLSR SHSLEW*
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10011573m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304565.10.0G-box-binding factor 4
SwissprotP427771e-151GBF4_ARATH; G-box-binding factor 4
TrEMBLR0IKE70.0R0IKE7_9BRAS; Uncharacterized protein
STRINGXP_006304565.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.11e-101G-box binding factor 4