PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011417m
Common NameCARUB_v10011417mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 466aa    MW: 51928.8 Da    PI: 5.6909
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011417mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.23.1e-07151211161
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                      e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++
  Carubv10011417m 151 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLET 211
                      78899*****************************************998887777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001703.3E-7151213IPR004827Basic-leucine zipper domain
SMARTSM003383.2E-9151215IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.036153216IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.1E-7155221No hitNo description
SuperFamilySSF579592.17E-6155210No hitNo description
CDDcd147021.66E-12161207No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MELEPISSCC SSSSSSGEDT AAANMTELEA AEALADLAQL AIMREQVFES ASSWGSKGKR  60
VRKRVKTESP PSDSLLKPPD SETLPTPDLA EERLMKEEEE EDVQPVIKEV TKAPVKTEMN  120
GETLKPNLAS TIRCSRSNGC GRSRQNLSEA EREERRIRRI LANRESARQT IRRRQAMCEE  180
LSKKAADLTY ENENLRREKD WALKEFQSLE TMNKHLKEQV SKSVKPDTKE HEEPPKPSQV  240
EMSTSSTPFY FYNQNPYQLF CWPHVTQSSN PMISPLEFAT SGGAAKTITP QEHEDPADDN  300
GQKTHFYVVP CPWFLSPPDQ SNGVSLGDQD TQRGTFSNGH HVDDSSARPL EVTKTLWSHL  360
PTRIKEEDSG SPETRPLYDL NESATEVLSE GGEGFAVTQQ AYSLKHEDIS EATNGVTPMP  420
PGHHVLISLP GKNQGSLAAA EARKRRKELT RLKNLHGRQC RMQVG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1442447RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10011417m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303620.10.0uncharacterized protein LOC17898066
TrEMBLR0II410.0R0II41_9BRAS; Uncharacterized protein
STRINGXP_006303620.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein