PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011345m
Common NameCARUB_v10012009mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 134aa    MW: 16021.7 Da    PI: 9.7911
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011345mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.12.3e-131049140
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                     k+ien++ r  tf++R+  i+KKA ELS   d+ev+v+++
  Carubv10011345m 10 KFIENERSRLSTFCRRQCSIFKKADELSKIPDVEVCVLLL 49
                     79***********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-6261IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.998249IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-13362IPR002100Transcription factor, MADS-box
CDDcd001201.62E-12447No hitNo description
PRINTSPR004041.0E-5424IPR002100Transcription factor, MADS-box
PfamPF003199.3E-121149IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-52439IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MAPRQKREIK FIENERSRLS TFCRRQCSIF KKADELSKIP DVEVCVLLLL RKRNQEELEK  60
SKMLEKVELE DLVAFKEKLE ALRADRKRRH EEMKASATLL MLSEETENKK MKIEADPREK  120
YELRPRIPRN YVE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
185111RKRRHEEMKASATLLMLSEETENKKMK
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10011345m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306046.24e-82uncharacterized protein LOC17898799
TrEMBLR0GPW61e-77R0GPW6_9BRAS; Uncharacterized protein
STRINGXP_006304928.12e-78(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16164513
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47760.14e-24AGAMOUS-like 102