PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011075m
Common NameCARUB_v10011075mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 217aa    MW: 24606.2 Da    PI: 9.2171
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011075mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.74.2e-2056103249
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 
                       i ++s+rqvtfskRr g++KK  ELSvL++a++avi fs  +++y +
  Carubv10011075m  56 EIIEESKRQVTFSKRRRGLFKKSAELSVLTGAKIAVITFSRCNRIYRF 103
                      577899**************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-2247106IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.21247107IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-2148121IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-174969IPR002100Transcription factor, MADS-box
PfamPF003197.1E-2057103IPR002100Transcription factor, MADS-box
CDDcd002662.35E-1961118No hitNo description
PRINTSPR004042.6E-176984IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-1784105IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEEERETSSM TCVTSKDPFQ IPNEAVSKPK KEPTTTTSTT KTPKTTRGRQ KIEIKEIIEE  60
SKRQVTFSKR RRGLFKKSAE LSVLTGAKIA VITFSRCNRI YRFGHVDALI DKYLRNSPVK  120
LEGCSGNNVA EEESKRPWWE RPVESVPEEE LEDYIAALSV LRENLGKKII AMSNDRPVEI  180
VPAWPINMMG WKPTMDMQNM ENPTDGITRC RVGQNG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10011075m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934621e-171AB493462.1 Arabidopsis thaliana At1g17310 mRNA for hypothetical protein, partial cds, clone: RAAt1g17310.
GenBankAY1412401e-171AY141240.1 Arabidopsis thaliana MADS-box protein AGL100 mRNA, complete cds.
GenBankBT0252841e-171BT025284.1 Arabidopsis thaliana At1g17310 mRNA, complete cds.
GenBankCP0026841e-171CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankDQ4462581e-171DQ446258.1 Arabidopsis thaliana clone pENTR221-At1g17310 MADS-box protein (At1g17310) mRNA, complete cds.
GenBankDQ6528411e-171DQ652841.1 Arabidopsis thaliana clone 0000016569_0000011566 unknown mRNA.
GenBankT13M221e-171AC026479.2 Sequence of BAC T13M22 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305901.11e-159agamous-like MADS-box protein AGL61
TrEMBLR0I8U31e-157R0I8U3_9BRAS; Uncharacterized protein
STRINGXP_006305901.11e-158(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46972052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17310.11e-105M-type_MADS family protein