PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10010430m
Common NameCARUB_v10010430mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 179aa    MW: 20424.3 Da    PI: 8.4485
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10010430mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.79.8e-161564150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krie +  r vt+skR+ngi  K  ELSvLCd++va + +  +gk y++ 
  Carubv10010430m 15 KRIEREEERLVTLSKRKNGIYTKLCELSVLCDVNVAFLGYTGSGKPYTFG 64
                     79**********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-17766IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-21777IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.39767IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-15929IPR002100Transcription factor, MADS-box
PfamPF003191.9E-161663IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-152944IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-154465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MNSKKTKGKQ KINIKRIERE EERLVTLSKR KNGIYTKLCE LSVLCDVNVA FLGYTGSGKP  60
YTFGSPSFHA VAERFLNGEA SLSSSLQRSD DADYKAKIQE LCELYNNMVE QTRAEEAKAT  120
KAAASVEPLP EDVWWKVPLV EMKDQEEKKQ LLEKFEGLYE KLCDELTARN QSQRYCRK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10010430m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305697.11e-130agamous-like MADS-box protein AGL29
TrEMBLR0IJE01e-128R0IJE0_9BRAS; Uncharacterized protein
STRINGXP_006305697.11e-129(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46761352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29962.18e-49AGAMOUS-like 64