PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10010156m
Common NameCARUB_v10010156mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 239aa    MW: 27348 Da    PI: 9.6573
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10010156mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF711.1e-221762449
                     -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                      n++n qvtfskRr g++KKA+EL++LCda++a+++fs++gk++ +
  Carubv10010156m 17 TNETNLQVTFSKRRSGLFKKASELCTLCDANIAILLFSPSGKVFSF 62
                     699****************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.399666IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-33665IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-24772IPR002100Transcription factor, MADS-box
CDDcd002655.83E-31772No hitNo description
PRINTSPR004042.2E-20828IPR002100Transcription factor, MADS-box
PfamPF003194.8E-241662IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-202843IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-204364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MVKNNLGRRK VEMVKMTNET NLQVTFSKRR SGLFKKASEL CTLCDANIAI LLFSPSGKVF  60
SFGHPDLSLL LDNSPERISN IDLDHGSRNP YLQMLNDRYA ELMAGKEREQ MKRAMIVQNQ  120
RRNNEPDNWW RISTEELSFG QLARMKLALE VLRRKVEETA SQFHQTNANY YIGSSGTAAS  180
EPVNGGNVST NQELFHPIYS LPFGFNVMNR TPAGYNHTLI HQNLEFKHPH PYHGPRYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A4e-15671166MEF2 CHIMERA
6byy_B4e-15671166MEF2 CHIMERA
6byy_C4e-15671166MEF2 CHIMERA
6byy_D4e-15671166MEF2 CHIMERA
6bz1_A5e-15671166MEF2 CHIMERA
6bz1_B5e-15671166MEF2 CHIMERA
6bz1_C5e-15671166MEF2 CHIMERA
6bz1_D5e-15671166MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function as a floral promoter operating upstream of known floral activators in the autonomous pathway. {ECO:0000269|PubMed:16899218}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10010156m
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304156.11e-180agamous-like MADS-box protein AGL28
SwissprotQ9LMM83e-87AGL28_ARATH; Agamous-like MADS-box protein AGL28
TrEMBLR0I4791e-179R0I479_9BRAS; Uncharacterized protein
STRINGCagra.1968s0094.1.p1e-180(Capsella grandiflora)
STRINGXP_006304156.11e-180(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17507710
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01530.11e-89AGAMOUS-like 28
Publications ? help Back to Top
  1. Cheng JZ,Zhou YP,Lv TX,Xie CP,Tian CE
    Research progress on the autonomous flowering time pathway in Arabidopsis.
    Physiol Mol Biol Plants, 2017. 23(3): p. 477-485
    [PMID:28878488]
  2. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]