PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009328m
Common NameCARUB_v10009328mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family G2-like
Protein Properties Length: 404aa    MW: 45663.3 Da    PI: 8.0002
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009328mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.2e-32228281255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Carubv10009328m 228 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 281
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15225281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28226281IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-23228281IPR006447Myb domain, plants
PfamPF002492.7E-7229280IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRS TTDQEDHEEL DLGFWRRALD SRTSSLVSNS  60
SSKPTNHPFQ DLSLSNNSHH HQQQQNHHHH HQPHLLPNCN GSNILSSFQF PTQQHQQQQQ  120
HLQGFLAHDL NTHLRPIRGI PLYHNPPPPQ HQHHRPPPPC FPFDPSSLIP SSSPSLTGNN  180
NSFNTSNVSN SGLITNPNYH NHHHNHHQTL NRARFMPRFP AKRSMRAPRM RWTTTLHARF  240
VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TVKTTDKAAA SSGQSDVYEN  300
GSSGDNNSDD WMFDMNRKSR DSEEMTNPTT EKSNGLWTNS SGEARLHGKL IDNVAEIMLP  360
SEKEIDGKCS SYERISSEEM SSSSISGTSP FKPNLEFTLG RSH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307698.10.0hypothetical protein CARUB_v10009328mg
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLR0GXP90.0R0GXP9_9BRAS; Uncharacterized protein
STRINGAT1G32240.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-119G2-like family protein