PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009177m
Common NameCARUB_v10009177mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 439aa    MW: 47066 Da    PI: 10.0214
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009177mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.91.2e-14360415560
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                      +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+ +  ++ ++ ++ +
  Carubv10009177m 360 RRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENDELQRKQAKIMEMQKNQE 415
                      79***************************************999888888876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-13356420IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.346358421IPR004827Basic-leucine zipper domain
PfamPF001703.5E-12360416IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.8E-14360410No hitNo description
CDDcd147077.99E-28360414No hitNo description
SuperFamilySSF579591.48E-10360409No hitNo description
PROSITE patternPS000360363378IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
ILVCRLGWEQ ILQKKMDGNV SFKNNNLGNE PPGDGGVGGL TRPGLTRQGS IYSLTFDEFQ  60
TSLGKDFGSM NMDELLKNIW SAEETQAMAS GMVPVTGGGQ EGLQLQKQGS LTLPRTLSQM  120
TVDQVWKDLS KVGSSGVGGM SLSQAQAQAQ NQNQSQSQRQ QTLGEVTLEE FLVRAGVVRE  180
EAQIAAKAQI AENNKGGYFG NEANTGFTVG FQQPSPRVVA AGVMGNLGAE NANPLQVQGS  240
SLPLNVNGAR SAYQQPQQQQ PIMPKQPGFG YGTQIGQLNS PGIRGGGIMG LGDQSQTNNM  300
GLVQGAAAVI PGAVSPVTPL SSEGLGKSNG DCSSLSPSPY MFNGGVRGRK SGTVEKVVER  360
RQRRMIKNRE SAARSRARKQ AYTVELEAEV AKLKEENDEL QRKQAKIMEM QKNQEMELRN  420
LVQGGPKKRL RRTESGPW*
Functional Description ? help Back to Top
Source Description
UniProtInvolved in ABA and stress responses and acts as a positive component of glucose signal transduction. Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10009177m
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA), cold and glucose. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0171600.0AB017160.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 1 (AREB1), complete cds.
GenBankAF0935450.0AF093545.1 Arabidopsis thaliana clone 2 abscisic acid responsive elements-binding factor (ABRE) mRNA, complete cds.
GenBankBT0264430.0BT026443.1 Arabidopsis thaliana At1g45249 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307554.20.0ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X1
RefseqXP_023632910.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 5 isoform X1
SwissprotQ9M7Q40.0AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLR0GWZ70.0R0GWZ7_9BRAS; Uncharacterized protein (Fragment)
STRINGXP_006307554.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-177abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Gao S, et al.
    ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis.
    Mol Plant, 2016. 9(9): p. 1272-1285
    [PMID:27373216]
  2. Seok HY, et al.
    Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response.
    Planta, 2017. 245(2): p. 329-341
    [PMID:27770200]