PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10008993m
Common NameCARUB_v10008993mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 484aa    MW: 54068.3 Da    PI: 7.092
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10008993mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.86.2e-10277333561
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                      kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l  
  Carubv10008993m 277 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQSEATSLSAQLTLLQRDTNGLSV 333
                      9*******************************************9999877666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.1E-15273337IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.818275338IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-10277331No hitNo description
SuperFamilySSF579591.13E-10277328No hitNo description
PfamPF001702.3E-8277329IPR004827Basic-leucine zipper domain
CDDcd147035.43E-24278327No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MFFFFFFFAL LSRRIDLSAP HLSLSPSFPT YVLSSPFLWF RRSLFCFGVW RLLTRSLSWG  60
LGQVLGMEKE KSPAPPSGGL PPPSGRYSTF SPNGSSFAMK AESSFPHLTP TGSSSSDANR  120
FSHDISRMPD NPPKNLGHRR AHSEILTLPD DLSFDSDLGV VGAADGPSFS DDTDEDLMFM  180
YLDMDKFNSS ATSTSQMGEP SEPAWRNELG STSNLQSTPG SSSERPRIRH QHSQSMDGST  240
TIKPEMLMSG NEDVSGVDSK KAISAAKLSE LALIDPKRAK RIWANRQSAA RSKERKMRYI  300
AELERKVQTL QSEATSLSAQ LTLLQRDTNG LSVENNELKL RVQTMEQQVH LQDALNDALK  360
EEVQHLKVLT GQGTPNGASM MNYGSFGPNQ QFYPNNQSMH TVLAAQQFQQ LQIQSQKQQQ  420
QQQQQQQQFQ FQQQQLYQLQ QQQQRLQQQE QQSGASELRR PMPSQGQKES VASPDLEASS  480
TKD*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10008993m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4198540.0AJ419854.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
GenBankAK2296660.0AK229666.1 Arabidopsis thaliana mRNA for bZip transcription factor AtbZip69, complete cds, clone: RAFL19-85-B03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023645254.10.0probable transcription factor PosF21
RefseqXP_023645255.10.0probable transcription factor PosF21
SwissprotQ040881e-179POF21_ARATH; Probable transcription factor PosF21
TrEMBLR0INM30.0R0INM3_9BRAS; Uncharacterized protein
STRINGXP_006307367.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.10.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]