PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007644m
Common NameCARUB_v10007644mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 248aa    MW: 28631.5 Da    PI: 7.1449
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007644mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.27.6e-221962649
                     HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       n qvtfskRr g++KKA+EL++LC+ae+++i+fs+ gk+y +
  Carubv10007644m 19 VGNLQVTFSKRRFGLFKKASELCTLCGAEILLIVFSPGGKVYAF 62
                     5688**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-30665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.226666IPR002100Transcription factor, MADS-box
CDDcd002654.04E-35782No hitNo description
SuperFamilySSF554553.01E-26789IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-17828IPR002100Transcription factor, MADS-box
PfamPF003194.3E-222162IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-172843IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-174364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MVRSNKGRQK IVMEKMVNVG NLQVTFSKRR FGLFKKASEL CTLCGAEILL IVFSPGGKVY  60
AFGHPDVREL IDRFLNRNHN SLVPFQPNNR LQLAQFRPDL NIQYLNDVLT FMVDRHEEEK  120
EARVKLEVMR QAREKRGSTW YEKDVKDLDM RETQKLIHDL EDVKKKLMSE MSQHSLQNYM  180
VESSGFTGGS NDDGGMDLQF DPNGNAFNYN PNMYFPNHAP FVGYTNDEFM VPMSNLNYMS  240
SYNNESS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10007644m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286101.10.0agamous-like MADS-box protein AGL62
TrEMBLR0GQ660.0R0GQ66_9BRAS; Uncharacterized protein
STRINGXP_006286101.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142941022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36590.17e-95M-type_MADS family protein