PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007456m
Common NameCARUB_v10007456mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 353aa    MW: 39776.4 Da    PI: 6.2531
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007456mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF641.6e-20958251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     + +n+s  ++ +s+R++ i+KKAe LS+LCd+ev+vi +++ g+l+++++
  Carubv10007456m  9 SCSNSSSSSTRLSNRLANIFKKAEQLSILCDIEVCVIHYGPGGELQTWPK 58
                     679*********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0049859IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.2411260IPR002100Transcription factor, MADS-box
PfamPF003197.0E-131256IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-141292IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MRSLPSSSSC SNSSSSSTRL SNRLANIFKK AEQLSILCDI EVCVIHYGPG GELQTWPKEK  60
SKVRDMALRY SQLNEALRRK KRVDLSEFLN EKKHKGLENL EKKRKTTGLE KKPVDVLKYP  120
ISDHYSPNQI SKLIQSLELN VSKLQERLRF VESQKLQSLA SSSLNHQTQS LNPSQFSLFM  180
YNHGDNTLSQ IPVSASNLNQ DFSALLQESQ LKNQLMKQEL CDYDQNINIS DMYNTNNSFQ  240
HPCVSNKETV QESLNNFGAM NQLMQKECYG GDQNLFTSDI TYSNVPDPSL SNTVSYEFCS  300
DTCGNNMVGN TSFSQDITDM SSNYDFNFDE SSLLQTSTLP SISTVSNNSM FL*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10007456m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0106992e-69AB010699.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MSN9.
GenBankAY1412232e-69AY141223.1 Arabidopsis thaliana MADS-box protein AGL43 mRNA, complete cds.
GenBankCP0026882e-69CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282935.20.0agamous-like MADS-box protein AGL75
SwissprotQ9FLL01e-119AGL75_ARATH; Agamous-like MADS-box protein AGL75
TrEMBLR0GXE70.0R0GXE7_9BRAS; Uncharacterized protein
STRINGXP_006282935.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41200.11e-110AGAMOUS-like 75
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]