PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007448m
Common NameCARUB_v10007448mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family CPP
Protein Properties Length: 676aa    MW: 73652.2 Da    PI: 5.9643
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007448mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.9e-16375413240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Carubv10007448m 375 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 413
                      689**********************************96 PP

2TCR51.12.7e-16460498139
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Carubv10007448m 460 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 498
                      589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19374415IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.543375500IPR005172CRC domain
PfamPF036386.5E-12377412IPR005172CRC domain
SMARTSM011143.7E-17460501IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11462498IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MDTPQKSIPQ IGTPISKSRF EDSPVFNYIN SLSPIRPVKS IQNPHQFSSL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHISS SHPTDPVDSR EDESTSNEAV SSEAEGVNID ASKPEEASTE  120
MVLPQTSPGS PVASPCGREA TDLSLVPYAP SQGGNGSCED AGMELQKMYD NVQGKTETPD  180
WESLISDASE LLIFDSPDAS EAFRCFMMQR ASTSEARFST GVGMQTTQPD ANKKPESSDA  240
IPYEAVSLLH RGIRRRCLDF EMPGNKQNFG ENNTAACESS SRCVVPSIGL HLNAIAMSSK  300
DCKTNVTHDY SCSGNIQVGL QSSISSTLQE PLDQTEIESR EDADQDVPVE PALQELNLSS  360
PKKKRVKLDS GEGESCKRCN CKKSKCLKLY CECFAAGVYC IEPCSCIDCF NKPIHEDTVL  420
ATRKQIESRN PLAFAPKVIR NSESVLEAGD DASKTPASAR HKRGCNCKKS NCLKKYCECY  480
QGGVGCSINC RCEGCKNAFG RKDGSSSVDM EAEQDEENET SDKSRTAKSQ QNSEVLMRKE  540
SSSGLPTTPT YRQELVQLPF SSSKNRMPPP QSLLGGGSSN GIYNGQFLRR PDISLSQSRI  600
EKSFETVTED RPEEMPEILI HSPIPNIKSV SPNGKRVSPP HMESSSSGSI LGRRSGGRKL  660
ILQSIPSFPS LTPQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1737949714120Protein lin-54 homolog
5fd3_B3e-1737949714120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1360367PKKKRVKL
2360368PKKKRVKLD
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10007448m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615391e-128AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankCP0026871e-128CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973371e-128Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282514.10.0protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGXP_006282514.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]