PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007372m
Common NameCARUB_v10007372mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family CPP
Protein Properties Length: 594aa    MW: 63186 Da    PI: 7.9631
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007372mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14124163141
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  Carubv10007372m 124 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 163
                      589**************************.********986 PP

2TCR50.73.7e-16209248140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Carubv10007372m 209 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 248
                      589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16124164IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.378125249IPR005172CRC domain
PfamPF036387.4E-11126161IPR005172CRC domain
SMARTSM011141.5E-19209250IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12212247IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MSEGGGGGEF PPKKDGVEEG FPAKNPARQL DFTGGSDEHS LSKAATAPTV VATAAVKPIV  60
PTSSVPSTIR PGMTIAIGQV RPVATTPILP SQALILNAPI RHPVPDSPQA RARPIVEARD  120
GTPQKKKQCN CKHSRCLKLY CECFASGTYC DGCNCVNCFN NVDNEPARRE AVEATLDRNP  180
FAFRPKIASS PHGVRDKRED IGEVVLLGKH NKGCHCKKSG CLKKYCECFQ ANILCSENCK  240
CLDCKNFEGS EERQALFHGE HANHMAYLQQ AANAAITGAV GSSGFAPSPV PKRRKGQDIM  300
FNQGTKDSSR LGQFPQVNSG RTTGPTSGTS PSPVSRAGGN ASSAPSKFVY RSLLADIIKP  360
QDVKALCSVL VTVAGEAAKT LTAQRKEKEN RVEDQTDTSL ASSAQDHSQD SKDVEMVATD  420
ESQADKSGPE DSNSDGVDAS KAKPLSPATL ALMCDEQDTI FMVAAASPNR SVDPGGCGTN  480
SQSQSEIYAE QERVVLTRFR DCLSRVISYA ELKESKCSSL ARKHQQPPAT ATVKTENGIQ  540
QQVPIVNGAS RTTSQPTVDI PQPLQLMNTT PAAAAANTHH LHNPPALSEK KDP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-3212625811132Protein lin-54 homolog
5fd3_B3e-3212625811132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10007372m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285877.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLR0H2810.0R0H281_9BRAS; Uncharacterized protein
STRINGXP_006285877.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein