PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006905m
Common NameCARUB_v10006905mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family B3
Protein Properties Length: 472aa    MW: 53094.9 Da    PI: 6.7485
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006905mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3598.5e-1919951094
                     HHHTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3 10 vlksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                      ++++ l +p kf+++h  g  k+ ++t+ l +  s rsW+vk+  ++++    lt+GWkeFv+a++L+ gDf+vF+++g++ f  +v
  Carubv10006905m 19 GFENH-LNIPVKFFSDHivG--KHDGRTVNLISdASERSWQVKM--QGHR----LTDGWKEFVEAHDLRIGDFLVFRHEGDMLF--NV 95
                     56666.9**********743..456778988876999*******..6665....***********************9998877..44 PP

2B3672.8e-21153247399
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      +  +++++l+++ +++p +fa+++g++ke++ +++l++e+g+sW  +++ +++  r ++ +GW +F+ an+L++gD+ +F+l  ++ +++v+++
  Carubv10006905m 153 SLSVTASNLSRDTVCVPIHFAKRNGLNKERQ-EIVLMNEEGKSWASEVKSWGGC-RLTIVRGWTSFCTANNLQVGDSRTFRLLPNTAETPVFQL 244
                      5668999********************9875.****************988885.788999*********************9999999***99 PP

                      E-S CS
               B3  97 frk 99 
                      f+ 
  Carubv10006905m 245 FSP 247
                      975 PP

3B345.51.4e-14270365197
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                      f+k + ++++l +g   lp +f++e+g+++++   ++l d++  +W++kl+ +k  g   ++ ++GWk+F+ an++ +g++++++l++  + ++
  Carubv10006905m 270 FVKLTPTPNSLHLGKQHLPASFTRENGLINPG--NIVLVDKNRAEWSMKLKADKATGLmyIISGNGWKSFCAANEIVVGESLILELIQ-GGVTP 360
                      7788888899999999************9776..6***************886666655444569*********************98.66667 PP

                      EEEEE CS
               B3  93 vvkvf 97 
                      ++k+ 
  Carubv10006905m 361 LLKFS 365
                      77766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-255103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.77E-228108IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.4519101IPR003340B3 DNA binding domain
CDDcd100174.95E-191096No hitNo description
SMARTSM010192.4E-2512101IPR003340B3 DNA binding domain
PfamPF023625.9E-132293IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.3E-20144241IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-19145240IPR015300DNA-binding pseudobarrel domain
CDDcd100174.33E-18151246No hitNo description
PROSITE profilePS5086314.762151248IPR003340B3 DNA binding domain
PfamPF023622.4E-20152246IPR003340B3 DNA binding domain
SMARTSM010191.0E-22152248IPR003340B3 DNA binding domain
CDDcd100171.12E-16268364No hitNo description
Gene3DG3DSA:2.40.330.101.3E-15268367IPR015300DNA-binding pseudobarrel domain
PfamPF023627.2E-14270366IPR003340B3 DNA binding domain
SuperFamilySSF1019361.82E-16270371IPR015300DNA-binding pseudobarrel domain
SMARTSM010199.1E-25270368IPR003340B3 DNA binding domain
PROSITE profilePS5086313.183270367IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MANALSRTKP HFFQPLIPGF ENHLNIPVKF FSDHIVGKHD GRTVNLISDA SERSWQVKMQ  60
GHRLTDGWKE FVEAHDLRIG DFLVFRHEGD MLFNVTALGP SCCEIQYSQS QPPSHEEGEE  120
SNETEVSSRS EKQVEENVKT ECDQFSSDLN CFSLSVTASN LSRDTVCVPI HFAKRNGLNK  180
ERQEIVLMNE EGKSWASEVK SWGGCRLTIV RGWTSFCTAN NLQVGDSRTF RLLPNTAETP  240
VFQLFSPTKS ERRIQYAEGC IDGKTGEHRF VKLTPTPNSL HLGKQHLPAS FTRENGLINP  300
GNIVLVDKNR AEWSMKLKAD KATGLMYIIS GNGWKSFCAA NEIVVGESLI LELIQGGVTP  360
LLKFSSKMEE PPFEAEAQAH KRARFQTWSQ ETEPNLKMRE KTTEEGEASR ASNKSSGNQE  420
NLHQKQPVPV SNQVAKVKDS VVDALTSIRR YMAELETTKQ KLEISLKEIN DL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282869.10.0hypothetical protein CARUB_v10006905mg, partial
SwissprotQ8H2D10.0REM8_ARATH; B3 domain-containing protein REM8
TrEMBLR0F2840.0R0F284_9BRAS; Uncharacterized protein (Fragment)
STRINGscaffold_701042.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.10.0B3 family protein