PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006890m
Common NameCARUB_v10006890mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 503aa    MW: 55769.4 Da    PI: 6.829
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006890mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.11.1e-25208264259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +DgynWrKYGqK+vk+ + +rsYYrCt+++C +kk +e+s++ +kvvei+++g H he
  Carubv10006890m 208 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSECFAKK-IECSNDSGKVVEIVNKGLHSHE 264
                      7********************************98.*********************8 PP

2WRKY97.31e-30371428259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++++v+itY+g Hnh+
  Carubv10006890m 371 GDGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVENKTAVIITYKGVHNHD 428
                      5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.6E-20204266IPR003657WRKY domain
SuperFamilySSF1182909.29E-20204266IPR003657WRKY domain
SMARTSM007747.5E-24207265IPR003657WRKY domain
PfamPF031066.0E-17209263IPR003657WRKY domain
PROSITE profilePS5081116.972209266IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.9E-32355430IPR003657WRKY domain
PROSITE profilePS5081131.984365430IPR003657WRKY domain
SuperFamilySSF1182905.49E-27366430IPR003657WRKY domain
SMARTSM007741.9E-34370429IPR003657WRKY domain
PfamPF031069.0E-24372428IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
RICSFLFYFS PTKTHEEKER NKDNRIRPSM EDSVIDETEV YAVEKSTPET EKSEKLEPEK  60
ELHNGLSQLR DDESLGTIGE DMEDLHHEAV RETLDKDQVE GVRENSSVEP NGEDLVVVKE  120
TDCAKETVVS TIVPVEEVEE NLEVEISPCL TASSDSITVK PSLSSDPTTA SAAQGLSLVS  180
VPAKQEQRSD SLVVNRLSVS PVPRTPARDG YNWRKYGQKQ VKSPKGSRSY YRCTYSECFA  240
KKIECSNDSG KVVEIVNKGL HSHEPPRKNS FSSREIRAAS AIRPVSKDNT VVEELTIVPS  300
GSDPAASAKE NICESQPFIE RKRHCENEAV DEPEPKRRLK KENSQSSDSV SKPGKKNKFV  360
VHAAGDVGIC GDGYRWRKYG QKMVKGNPHP RNYYRCTSAG CPVRKHIETA VENKTAVIIT  420
YKGVHNHDMP VPKKRHGPPS SMLVAAAAPT SMRTRTDDQV NIPTSSQRKS EKQSNEAVDV  480
GGEKVMESAR TLLSIGFEIK QC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-25361431878Probable WRKY transcription factor 4
2lex_A3e-25361431878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0051100.0BT005110.1 Arabidopsis thaliana clone U20909 putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
GenBankBT0040860.0BT004086.1 Arabidopsis thaliana clone RAFL15-37-C10 (R20909) putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285471.10.0hypothetical protein CARUB_v10006890mg, partial
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLR0GNC40.0R0GNC4_9BRAS; Uncharacterized protein (Fragment)
STRINGAT4G30935.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32