PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006654m
Common NameCARUB_v10006654mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 340aa    MW: 38273.7 Da    PI: 8.1973
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006654mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.31.8e-22655251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     ++++ sn + ++s+R+++i+KKA+ LS+LCd+ev+vi ++++g+l+++++
  Carubv10006654m  6 SSSSCSNSSSSLSNRLETIFKKASHLSILCDIEVCVIHYGPDGELQTWPK 55
                     678999******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0034256IPR002100Transcription factor, MADS-box
PROSITE profilePS5006610.541157IPR002100Transcription factor, MADS-box
PfamPF003191.6E-121253IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-141489IPR002100Transcription factor, MADS-box
CDDcd002662.74E-142081No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MRSLPSSSSC SNSSSSLSNR LETIFKKASH LSILCDIEVC VIHYGPDGEL QTWPKEKSKV  60
RDMALRYSQL NKALRRKKSV NLDGFLNEKR LKGLENLNKK RKTTSDLERK PVDVLKYPIS  120
DHYSPNQISK LIQSLELNVS KLQERLRFVE SQKLQSLASS SLNHQTQSLN PSQFSLFMYN  180
HGNNTISQIP VSASNINQDF SALLQESQLK NQIIKQELCG YDQNTSISDI TNNSFQHPCV  240
SNKEHYSAVQ ESVDNFGSMN QLMQKDYFYG GYQNLSTSDI TYRNFPDPSL SNTVSYEFCS  300
NTCGNNTGFS QDMGSSYDES SLLHATSTLP SLCNNSRFV*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction. {ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10006654m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285278.20.0agamous-like MADS-box protein AGL75
SwissprotQ9FLL01e-122AGL75_ARATH; Agamous-like MADS-box protein AGL75
TrEMBLR0F9410.0R0F941_9BRAS; Uncharacterized protein
STRINGXP_006285278.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41200.11e-115AGAMOUS-like 75
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]