PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006209m
Common NameCARUB_v10006209mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 209aa    MW: 23619.3 Da    PI: 4.7897
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006209mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF28.22.4e-091249239
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                     +i+ k  r v fs+Rrng+  KA+ L+ L +ae a++ 
  Carubv10006209m 12 KIQKKESRAVAFSQRRNGLYNKASQLCRLSGAEMAILT 49
                     799999*****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.2E-7366IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.002348IPR002100Transcription factor, MADS-box
CDDcd002661.15E-16482No hitNo description
SuperFamilySSF554551.7E-13577IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-5525IPR002100Transcription factor, MADS-box
PfamPF003197.5E-111263IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-52540IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGGKKRKIPM EKIQKKESRA VAFSQRRNGL YNKASQLCRL SGAEMAILTT PCSSSSHASF  60
YSFGHSSADG VVAAFLDDQR PVTVTDEENL GLGLWWEDDD LAESENPEEL KCAIESMSKM  120
LRNLKEVRLQ RDDQDDVKNN DIKKKDLVSH ETRNLDQTLN LKFTSATSGN VPRNFNKIAQ  180
EQDQIMAARN LDDGYTNQEL DLDQLIDFE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10006209m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284913.21e-155agamous-like MADS-box protein AGL97
SwissprotQ9C6332e-49AGL97_ARATH; Agamous-like MADS-box protein AGL97
TrEMBLR0F8651e-154R0F865_9BRAS; Uncharacterized protein (Fragment)
STRINGXP_006284913.11e-155(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46408.14e-31AGAMOUS-like 97
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]