PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005978m
Common NameCARUB_v10005978mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 144aa    MW: 16513.8 Da    PI: 6.2586
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005978mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.11.6e-121667556
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
                     ++ +r+ +NRe+ArrsR +K++ ++ L+  v  L++eN++    ++  ++++
  Carubv10005978m 16 RKRKRMLSNRESARRSRMKKQKLLDDLTAQVNHLKKENSDIVTSVSITTQHY 67
                     7889**********************************98876666555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-181276IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-101356No hitNo description
PROSITE profilePS5021710.0711477IPR004827Basic-leucine zipper domain
PfamPF001705.7E-101557IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-121669No hitNo description
CDDcd147021.07E-171767No hitNo description
PROSITE patternPS0003601934IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0080149Biological Processsucrose induced translational repression
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MSPIILRSEE SLMEQRKRKR MLSNRESARR SRMKKQKLLD DLTAQVNHLK KENSDIVTSV  60
SITTQHYLTV EAENSVLRAQ LDELNHRLQS LNDIIEFLDS SNNNGMCSNP LVGLECDDFF  120
VNQMNMSYMM NQPLMASSDA LLY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11536RKRKRMLSNRESARRSRMKKQK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00470DAPTransfer from AT4G34590Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10005978m
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0230941e-150AL023094.2 Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20 (ESSA project).
GenBankAL1615851e-150AL161585.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 81.
GenBankAY0639791e-150AY063979.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds.
GenBankAY0963961e-150AY096396.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds.
GenBankCP0026871e-150CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023634019.12e-96bZIP transcription factor 11
SwissprotO656832e-88BZP11_ARATH; bZIP transcription factor 11
TrEMBLR0GL571e-100R0GL57_9BRAS; Uncharacterized protein
STRINGXP_006284716.11e-100(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.16e-91G-box binding factor 6
Publications ? help Back to Top
  1. Mair A, et al.
    SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants.
    Elife, 2016.
    [PMID:26263501]
  2. Sagor GH, et al.
    A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene.
    Plant Biotechnol. J., 2016. 14(4): p. 1116-26
    [PMID:26402509]
  3. Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W
    Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins.
    PLoS ONE, 2016. 11(4): p. e0153216
    [PMID:27073862]
  4. Wang XY, et al.
    Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis.
    Plant Physiol. Biochem., 2016. 107: p. 273-287
    [PMID:27337039]
  5. Weiste C, et al.
    The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth.
    PLoS Genet., 2017. 13(2): p. e1006607
    [PMID:28158182]
  6. Yamashita Y, et al.
    Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2.
    FEBS Lett., 2017. 591(9): p. 1266-1277
    [PMID:28369795]
  7. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  8. Lee DH,Park SJ,Ahn CS,Pai HS
    MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway.
    Plant Cell, 2017. 29(11): p. 2895-2920
    [PMID:29084871]
  9. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]