PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005907m
Common NameCARUB_v10005907mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 166aa    MW: 19346.5 Da    PI: 6.7217
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005907mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.62.8e-1372121554
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                      +++rrk +NRe+ArrsR RK+ +++eL   v  L +eN++L  +l++  +
  Carubv10005907m  72 RKQRRKLSNRESARRSRMRKQRQVDELWSQVMWLRNENHQLLHKLNRVLE 121
                      689****************************************9998755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.6E-1064121No hitNo description
SMARTSM003385.1E-1268132IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.6870133IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-1172121No hitNo description
PfamPF001701.8E-1172122IPR004827Basic-leucine zipper domain
CDDcd147023.16E-1773123No hitNo description
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MQPSMNVFSL HDHPPSYLSH FPTSSSPFCG NGQNPNPFYS FQTGVNSPQL MSLSNSTSDE  60
AEENHSDMIN ERKQRRKLSN RESARRSRMR KQRQVDELWS QVMWLRNENH QLLHKLNRVL  120
ESHEKAIEEN AQLKEETSEL KHMISDMTQL QNQSPFSCFR DEDIV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18491RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00533DAPTransfer from AT5G38800Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10005907m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284650.11e-120basic leucine zipper 43
SwissprotQ9FMC24e-90BZP43_ARATH; Basic leucine zipper 43
TrEMBLR0H2481e-118R0H248_9BRAS; Uncharacterized protein
STRINGXP_006284650.11e-119(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38800.12e-92basic leucine-zipper 43
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]