PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10005538m
Common NameCARUB_v10005538mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 259aa    MW: 28322.3 Da    PI: 5.6038
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10005538mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.3e-1091138552
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      k e+r   NReA r++R++Kka+ + Le++v  L a N++L k+l++ 
  Carubv10005538m  91 KGEKRPLGNREAVRKYREKKKAKAASLEDEVSRLRAVNQQLVKRLQNQ 138
                      6799999***********************************999863 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-1187154IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.86489155IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-1390155No hitNo description
PfamPF077161.9E-1491144IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.82E-791138No hitNo description
CDDcd146862.74E-1293146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MEDGELEFSN QEVFSSSEMG ELPPSNCSMD SFFDGLLMDT NAACTHTHTC NPTGPENTHT  60
HTCFHVHTKI LPDDSDEKVS TDDTAESCGK KGEKRPLGNR EAVRKYREKK KAKAASLEDE  120
VSRLRAVNQQ LVKRLQNQAT LEAEVSRLKC LLVDLRGRID GEIGSFPYQK PNIPSFSHMM  180
NPCNVQCDDE VYCPQNGFGG NTQEVASIND QGLSGCDFDQ LQCMANQNLG GNANGSFNNS  240
NASVSNKRKG GHRASRAV*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10005538m
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0723860.0AY072386.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds.
GenBankAY0861530.0AY086153.1 Arabidopsis thaliana clone 21838 mRNA, complete sequence.
GenBankBT0001600.0BT000160.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284366.10.0basic leucine zipper 19
SwissprotQ8VY761e-177BZP19_ARATH; Basic leucine zipper 19
TrEMBLR0GK700.0R0GK70_9BRAS; Uncharacterized protein
STRINGCagra.2350s0050.1.p0.0(Capsella grandiflora)
STRINGXP_006284366.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-166bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Henriques AR,Farias DDR,Costa de Oliveira A
    Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals.
    Genet. Mol. Res., 2017.
    [PMID:28671251]
  4. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]