PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004981m
Common NameCARUB_v10004500mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 398aa    MW: 43628.3 Da    PI: 5.7267
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004981mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.53.8e-10309356552
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l
  Carubv10004981m 309 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLL 356
                      899**************************************9988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-12305370IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.795307357IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.88E-11309357No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-11309357No hitNo description
PfamPF001702.1E-9309356IPR004827Basic-leucine zipper domain
CDDcd147032.52E-24310357No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MSQPNSFFSF DSLPPLSPSP FRDSLSPQPD HDVSMDDPDS GAFTSNASLP PSPFTRCNST  60
SSSSLRLPDS LPPRKSHRRS NSDIPTGFSS IILHNSLPFR PLDRSVSGGE SADWSKSSPF  120
VKKESTCERE GVGEREAMDD LFSAYMNLEN IDVLNSSEAD DSRNGNENRD DMDSSRASGT  180
KTNGSDTEGE SSSVNETANN NNTLISSGEK RESVKRRAAG GDIAPTSRHY RSVSVDSCFM  240
EKLSFGDESL KPPPSPGTMS RKVSPTNSVD GNSGAAFSIE FKNGEFTAAE MKKIMANDKL  300
AEMAMSDPKR VKRILANRQS AARSKERKMR YIVELEHKVQ TLQTEATTLS AQLTLLQVRG  360
LQYCNSALIG LVLLFLTILV ILHHYTERYD WADKSEQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10004981m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283456.10.0probable transcription factor PosF21
RefseqXP_023633706.10.0probable transcription factor PosF21
TrEMBLR0GVM20.0R0GVM2_9BRAS; Uncharacterized protein
STRINGXP_006283456.10.0(Capsella rubella)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-178bZIP family protein