PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004909m
Common NameCARUB_v10004909mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family HRT-like
Protein Properties Length: 419aa    MW: 46680.1 Da    PI: 9.2382
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004909mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like52.86.5e-17224252230
         HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                      CGv+ledG++C+++PvkgR+RC eHKG+R
  Carubv10004909m 224 CGVLLEDGTTCTTTPVKGRQRCTEHKGKR 252
                      ****************************9 PP

2HRT-like46.84.8e-15270300131
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                      iCGvil d   C+r+Pv  RKRCe HKGmR+
  Carubv10004909m 270 ICGVILPDMVRCRRPPVLRRKRCEDHKGMRV 300
                      8*****************************7 PP

3HRT-like25.32.6e-08340367229
         HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGm 29 
                      C +++ +G +C+r + kg K C++HK++
  Carubv10004909m 340 CEATTTNGLPCTRRAPKGSKKCWQHKDK 367
                      9*************************86 PP

4HRT-like63.52.9e-20386416131
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                      iCGv+l +GsvC++ PvkgRKRCeeHKGmR+
  Carubv10004909m 386 ICGVKLYNGSVCEKAPVKGRKRCEEHKGMRV 416
                      8*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MFKRDDYLRT NHDAAAISKW QGIARSMLLR KPISETAELR RTYADYSLIS RDLGPKIRVG  60
ASDKENFRKG KDCVGRYRVQ GAFPGLSDLG VGVICHDQGR KDAKDDDVLL ANLGQAESIR  120
YRLRSYGRSI AQQDLLKKLG DSVFMNPRKS GLSETILPVT QKRTSNKTEE NKPDSVEEIE  180
ISSDAAEKES NLLPSILRLS RSRPQPVSET HDDIVDGSDS ASGCGVLLED GTTCTTTPVK  240
GRQRCTEHKG KRRIPCEVPT TRECEQADEI CGVILPDMVR CRRPPVLRRK RCEDHKGMRV  300
NAFFFLLNPT ELEKAVKEEK SKPKTCTGMN QEDSGLNLLC EATTTNGLPC TRRAPKGSKK  360
CWQHKDKTVD HRSSENVQSA TISQVICGVK LYNGSVCEKA PVKGRKRCEE HKGMRVTS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026871e-147CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankAL1615641e-147AL161564.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 64.
GenBankAL0494831e-147AL049483.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F20B18 (ESSA project).
GenBankAL0491711e-147AL049171.1 Arabidopsis thaliana DNA chromosome 4, BAC clone (ESSA project).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283810.10.0hypothetical protein CARUB_v10004909mg
SwissprotF4JU691e-173ET1_ARATH; Protein EFFECTOR OF TRANSCRIPTION 1
TrEMBLR0GZV00.0R0GZV0_9BRAS; Uncharacterized protein
STRINGscaffold_701687.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29542763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26170.11e-151