PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004710m
Common NameCARUB_v10004710mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family B3
Protein Properties Length: 481aa    MW: 53754.1 Da    PI: 9.7918
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004710mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B333.29e-1119941294
                     HTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3 12 ksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                      +++ ++p  f +++  +++  +  +l+l++  s  +W+vkl  ++++    +++GW +F  a+ L++ D+++F++dg++ f  +v
  Carubv10004710m 19 HNSNPIIPQVFSTAYlkDLNDLG--KLKLTSdASDTTWDVKL--NGRR----FAGGWDDFSAAHCLRDDDVLLFRHDGEMVF--HV 94
                     45557899999999986555433..6777765999*******..8887....99*********************9987777..44 PP

2B3452e-14145238297
                      EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
               B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                      + + +++++l+++r+ ++k+  +++g++k+    + l+++sg+sW + l++++  g+ ++++GW +F++an+Lk g f  Fkl+  ++++++++
  Carubv10004710m 145 CLIGVTPSNLRLNRVNFSKHLSRSNGLSKRW-CGIDLMNLSGESWALGLQHDNFNGQDYISGGWTSFCHANELKPGSFYRFKLVL-NRTRPLLR 236
                      55668999*****************988763.36*****************999999899**********************986.56667777 PP

                      EE CS
               B3  96 vf 97 
                      ++
  Carubv10004710m 237 LC 238
                      77 PP

3B3733.8e-23274368197
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      f++v+ ++++l+sg+l+lp++fa+e+g+k++e  +++l d++g +W  ++   k++++++++ GW +F+ an+Lk+g+++++++++ +++++++
  Carubv10004710m 274 FLTVTFKHYMLQSGQLRLPRSFARENGIKQAE--EIILVDKNGVKWPSYVASPKQREEFYMAHGWTSFCAANKLKTGETFTLEFVRGEGTTPML 365
                      7889999*******************999655..8***************99999999***************************99***9**9 PP

                      EEE CS
               B3  95 kvf 97 
                      k++
  Carubv10004710m 366 KFC 368
                      987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.8E-13695IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-13696IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.756898IPR003340B3 DNA binding domain
CDDcd100175.18E-101095No hitNo description
SMARTSM010192.1E-1312100IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-14138238IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-12143238IPR015300DNA-binding pseudobarrel domain
CDDcd100176.81E-13143239No hitNo description
SMARTSM010192.1E-18144241IPR003340B3 DNA binding domain
PfamPF023626.1E-13144239IPR003340B3 DNA binding domain
PROSITE profilePS5086310.602144241IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-19267368IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.53E-20271370IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.9E-28274371IPR003340B3 DNA binding domain
PfamPF023629.8E-23274368IPR003340B3 DNA binding domain
PROSITE profilePS5086314.565274370IPR003340B3 DNA binding domain
CDDcd100176.29E-17274369No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MAVPLSSSQP SFVISLAGHN SNPIIPQVFS TAYLKDLNDL GKLKLTSDAS DTTWDVKLNG  60
RRFAGGWDDF SAAHCLRDDD VLLFRHDGEM VFHVTPSGRC FSQLQCKSCS SGDDETGDDE  120
SVSKNISRKK ESRIKAESSS SEIFCLIGVT PSNLRLNRVN FSKHLSRSNG LSKRWCGIDL  180
MNLSGESWAL GLQHDNFNGQ DYISGGWTSF CHANELKPGS FYRFKLVLNR TRPLLRLCSY  240
IIPERNRSGA NGKANVSEKY SREGGSASTK QNKFLTVTFK HYMLQSGQLR LPRSFARENG  300
IKQAEEIILV DKNGVKWPSY VASPKQREEF YMAHGWTSFC AANKLKTGET FTLEFVRGEG  360
TTPMLKFCFM AKAKQEEAPE ETGAPYQKRA RVSVEVGHSR RTQAPNKSSD DPKILQRKQP  420
LQHCSFSGEA KNVKQSIVNI LTGIKRFRSE LEIKEQSLKA SLLEIDALGE KVLKINKILK  480
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1337530.0AY133753.1 Arabidopsis thaliana clone U18158 unknown protein (At4g31620) mRNA, complete cds.
GenBankAY0639300.0AY063930.1 Arabidopsis thaliana unknown protein (At4g31620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283653.10.0hypothetical protein CARUB_v10004710mg
SwissprotQ8VZQ90.0REM3_ARATH; B3 domain-containing protein REM3
TrEMBLR0F5670.0R0F567_9BRAS; Uncharacterized protein
STRINGAT4G31620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96581537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31620.10.0B3 family protein