PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004637m
Common NameCARUB_v10004500mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 502aa    MW: 54843.7 Da    PI: 6.7958
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004637mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.15.2e-10413460552
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l
  Carubv10004637m 413 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLL 460
                      899**************************************9988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-12409474IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.795411461IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-11413461No hitNo description
Gene3DG3DSA:1.20.5.1703.4E-11413461No hitNo description
PfamPF001702.9E-9413460IPR004827Basic-leucine zipper domain
CDDcd147034.73E-25414461No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MGDTDKCNTD MIQRLPPSFG TSSSSSSSSS SSFPKNPIQQ LDLNPNLMRS TPQFPQFSKP  60
FSDTGKRIGV PPSHPNLIPP TSPYSQIPTS RQPNYNPGGG HSRSMSQPNS FFSFDSLPPL  120
SPSPFRDSLS PQPDHDVSMD DPDSGAFTSN ASLPPSPFTR CNSTSSSSLR LPDSLPPRKS  180
HRRSNSDIPT GFSSIILHNS LPFRPLDRSV SGGESADWSK SSPFVKKEST CEREGVGERE  240
AMDDLFSAYM NLENIDVLNS SEADDSRNGN ENRDDMDSSR ASGTKTNGSD TEGESSSVNE  300
TANNNNTLIS SGEKRESVKR RAAGGDIAPT SRHYRSVSVD SCFMEKLSFG DESLKPPPSP  360
GTMSRKVSPT NSVDGNSGAA FSIEFKNGEF TAAEMKKIMA NDKLAEMAMS DPKRVKRILA  420
NRQSAARSKE RKMRYIVELE HKVQTLQTEA TTLSAQLTLL QVRGLQYCNS ALIGLVLLFL  480
TILVILHHYT ERYDWADKSE Q*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10004637m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283456.10.0probable transcription factor PosF21
RefseqXP_023633706.10.0probable transcription factor PosF21
TrEMBLR0GYU50.0R0GYU5_9BRAS; Uncharacterized protein
STRINGXP_006283456.10.0(Capsella rubella)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.30.0bZIP family protein