PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004562m
Common NameCARUB_v10004562mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family B3
Protein Properties Length: 534aa    MW: 60351.4 Da    PI: 10.0076
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004562mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.11.6e-1323991296
                     HTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3 12 ksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                     +++ + +p  f +++  g +  e+ t  l++  s  +W +k+  ++++    l+kGW++F++a++L++gD++vF+++g+  f  +v+ 
  Carubv10004562m 23 NTS-ILIPEAFYSNYleGRQ--EGNTAELRSdMSEMTWIIKM--DGRR----LSKGWEKFAEAHNLQVGDILVFRHEGNLLF--HVTT 99
                     444.899*****99984433..4558888875888*******..9998....***********************8775444..5555 PP

2B3443.8e-14149238697
                      ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      +++++ +++ ++lp+ f+++ g++k ++ +++l+de+gr  ++kl+y+ + +r+  ++GW+ F+  ng ++g f+ + l++ +++++v++vf
  Carubv10004562m 149 VTASNQRLDSVCLPRGFTNSSGLSKLCN-EMILMDEKGRPSKIKLCYKESTNRFCASRGWRAFCCKNGHQTGCFLRLILVR-NGKTPVLRVF 238
                      5788889999********999*999775.**********************************************999998.6777899887 PP

3B343.36.6e-14300389697
                      ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      +++++ +++ + lpk  +++ g++k + k+++++de+gr+  ++l+y+k+s+r+  ++GW+ F+  ng + g f+ + l++ +++++ +++f
  Carubv10004562m 300 VTASNQRLDSFNLPKGLTTSSGLSKLC-KEIVFMDERGRTSILNLSYDKSSCRFKVRRGWRAFCCRNGHEIGSFLKLILVR-NGKTPILRIF 389
                      5788889999********9**999865.7*************************************************998.6666888887 PP

4B3581.7e-18428514390
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                       v ++ ++l+++rl+lp +  +++ +k  +  ++ l++++gr+W++ l+y+k+s+++ +++GWk F++ang k g +++Fkl++++++
  Carubv10004562m 428 VVSVTVSNLREDRLYLPVRLSRSNILK-GKFHEINLMNKHGRTWTLSLKYSKCSRKFSISRGWKCFCEANGQKPGCTFLFKLVRNRKA 514
                      66789999****************444.44569*************************************************987554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.1E-198104IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-189110IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.37911103IPR003340B3 DNA binding domain
CDDcd100174.62E-1412100No hitNo description
SMARTSM010191.9E-1714103IPR003340B3 DNA binding domain
PfamPF023622.5E-92494IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-13142235IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.122144241IPR003340B3 DNA binding domain
SuperFamilySSF1019364.71E-12145236IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.7E-15145241IPR003340B3 DNA binding domain
CDDcd100172.04E-12145239No hitNo description
PfamPF023628.9E-13149238IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-12290386IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-12294386IPR015300DNA-binding pseudobarrel domain
CDDcd100171.70E-11295390No hitNo description
PROSITE profilePS508638.854295392IPR003340B3 DNA binding domain
SMARTSM010193.1E-15296392IPR003340B3 DNA binding domain
PfamPF023621.2E-12300389IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.8E-20422518IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-18422517IPR015300DNA-binding pseudobarrel domain
CDDcd100178.30E-15426510No hitNo description
PROSITE profilePS5086313.366426522IPR003340B3 DNA binding domain
PfamPF023622.5E-17427514IPR003340B3 DNA binding domain
SMARTSM010196.9E-23427523IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MADSVLFSSA KPHFFKPILP GFNTSILIPE AFYSNYLEGR QEGNTAELRS DMSEMTWIIK  60
MDGRRLSKGW EKFAEAHNLQ VGDILVFRHE GNLLFHVTTF GQSSCEIRYS YSSQKDDKDV  120
KDKTGKVTTV KKTARNECSS VDTDFVVPVT ASNQRLDSVC LPRGFTNSSG LSKLCNEMIL  180
MDEKGRPSKI KLCYKESTNR FCASRGWRAF CCKNGHQTGC FLRLILVRNG KTPVLRVFPL  240
ERDEDNIAKC SKKTNQEVEH ESVKEEMKVD SGKLIRDRLV KKDPKSLCSS SHDTSFVVPV  300
TASNQRLDSF NLPKGLTTSS GLSKLCKEIV FMDERGRTSI LNLSYDKSSC RFKVRRGWRA  360
FCCRNGHEIG SFLKLILVRN GKTPILRIFP LEKDEGSIGK NSQNIKQEVE HESAKAESLS  420
LSDNSCFVVS VTVSNLREDR LYLPVRLSRS NILKGKFHEI NLMNKHGRTW TLSLKYSKCS  480
RKFSISRGWK CFCEANGQKP GCTFLFKLVR NRKAPVLLMT SLDGNTHQSK TGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283509.10.0hypothetical protein CARUB_v10004562mg
SwissprotF4KFT60.0REML3_ARATH; B3 domain-containing protein REM-like 3
TrEMBLR0F3W10.0R0F3W1_9BRAS; Uncharacterized protein
STRINGAT5G32460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17423910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G32460.10.0B3 family protein