PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004462m
Common NameCARUB_v10004462mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family B3
Protein Properties Length: 575aa    MW: 64568.9 Da    PI: 8.0315
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004462mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.71e-13601311794
                      E--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3  17 vlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                       +p +f  +h  g +  e+kt +l++  s  +We+k+     ++r  lt+GWkeFv an+ + gD+ vF+++g+  f  +v
  Carubv10004462m  60 NIPVTFYLKHlqGRN--EHKTAKLRTdASDTVWELKI---EDGQR--LTEGWKEFVTANDFRIGDVTVFRHEGDLVF--HV 131
                      79********85444..5667888775999*******...33334..9**********************8876555..44 PP

2B356.64.6e-18186276699
                      ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      ++ ++l ++ l++p  fa++ g+ k+++ +++l +e grsW++ l ++k++++++l+ GW++F++ang++ g   +Fkl++ +++++v++v+r+
  Carubv10004462m 186 VSVSNLYEDKLYVPVGFARSSGLCKKTG-KIVLLNELGRSWKLSLDHDKSGSKTYLRHGWRSFCNANGMNRGGY-TFKLVR-NSGTPVIQVCRA 276
                      5667778899***********9887665.9******************************************96.***998.7888******96 PP

3B372.45.6e-23290386198
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      ff+ +++ ++l ++ l+lp+ f++++g++k +  +++l++e+gr+W++ l+++k+ +++++++GW++F++ ngLk++D++ Fkl+  ++++ v+
  Carubv10004462m 290 FFSGFVTTSNLDHDALYLPRVFVSSNGLDKGRCDEMVLKNEDGRTWNLVLRHDKSNNSVLISRGWRSFCQVNGLKARDTFRFKLVI-TGGKHVL 382
                      78889999***************************************************************************975.5555566 PP

                      EEE- CS
               B3  95 kvfr 98 
                       +++
  Carubv10004462m 383 CLCS 386
                      6665 PP

4B348.41.7e-15474570199
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      f++ + ++++++s+ l+lp  f++++g+kk++  ++tl  ++g    v+l  +   gr  l++ Wk+F++ +g+k g+++v++l++++++ +v+
  Carubv10004462m 474 FVTLTFSPYSFRSNKLRLPLCFTRANGIKKPG--KITLLGRDGVNRMVRLLKDHENGRLRLGRDWKGFCRVHGVKIGESFVLELIWKKDAGPVL 565
                      67778899*******************99766..7***************99999999*****************************9999*** PP

                      EEE-S CS
               B3  95 kvfrk 99 
                      k++ k
  Carubv10004462m 566 KFCTK 570
                      99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.6E-17826IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.0E-746137IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.6E-1760137IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-1560144IPR015300DNA-binding pseudobarrel domain
PfamPF023624.3E-960128IPR003340B3 DNA binding domain
PROSITE profilePS5086310.99761137IPR003340B3 DNA binding domain
CDDcd100174.30E-961132No hitNo description
Gene3DG3DSA:2.40.330.101.5E-17175277IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.14E-17179281IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.887181277IPR003340B3 DNA binding domain
CDDcd100172.23E-16181275No hitNo description
SMARTSM010191.3E-22182277IPR003340B3 DNA binding domain
PfamPF023626.6E-17184276IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-19283385IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.02E-19286388IPR015300DNA-binding pseudobarrel domain
CDDcd100174.73E-18289386No hitNo description
PfamPF023625.1E-22290387IPR003340B3 DNA binding domain
PROSITE profilePS5086315.171290388IPR003340B3 DNA binding domain
SMARTSM010191.3E-26290388IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.0E-16466569IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-16468568IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.926474571IPR003340B3 DNA binding domain
CDDcd100173.33E-14474559No hitNo description
PfamPF023623.0E-15474570IPR003340B3 DNA binding domain
SMARTSM010191.3E-19474571IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MAESVLQTPK NPHFFQPLLP GFDSYLVLCL CLSSTIIYSL AYSKRYGSVL ETSYAFLLQN  60
IPVTFYLKHL QGRNEHKTAK LRTDASDTVW ELKIEDGQRL TEGWKEFVTA NDFRIGDVTV  120
FRHEGDLVFH VTALGLRGCE IEYTSSHSVD DDCDNHQENI ETRPVKKNPG REEDSSLDHS  180
CFVANVSVSN LYEDKLYVPV GFARSSGLCK KTGKIVLLNE LGRSWKLSLD HDKSGSKTYL  240
RHGWRSFCNA NGMNRGGYTF KLVRNSGTPV IQVCRAGCRP DAESSSDCSF FSGFVTTSNL  300
DHDALYLPRV FVSSNGLDKG RCDEMVLKNE DGRTWNLVLR HDKSNNSVLI SRGWRSFCQV  360
NGLKARDTFR FKLVITGGKH VLCLCSAETS RDTRVLECSE GTDVDSLSTD PSRAEESSET  420
EESEDNGRDN TIVKEDSEEE SIEDKSSLRE CSIAEKWKHS SRPGASSSSS QSRFVTLTFS  480
PYSFRSNKLR LPLCFTRANG IKKPGKITLL GRDGVNRMVR LLKDHENGRL RLGRDWKGFC  540
RVHGVKIGES FVLELIWKKD AGPVLKFCTK VNCV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283413.10.0hypothetical protein CARUB_v10004462mg
TrEMBLR0F4H10.0R0F4H1_9BRAS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-130B3 family protein