PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10003688m
Common NameCARUB_v10003688mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 137aa    MW: 16203.2 Da    PI: 6.5056
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10003688mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.72.9e-093288460
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60
                      kr rr+  NRe+ArrsR   k+++e+L++ v++  a N+ L ++  +l +++ +  
  Carubv10003688m 32 EKRLRRMTCNRESARRSRMQGKMKMERLKTQVEQVMASNQFLSDKYVSLLELSHQIL 88
                     59**************************************99998877777766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-92781No hitNo description
SMARTSM003382.5E-42993IPR004827Basic-leucine zipper domain
PfamPF077161.1E-103080IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.5313180IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.31E-73382No hitNo description
CDDcd147029.62E-153485No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MYLQNPHDED CFHVHDHHVE NHDQPSVVTD QEKRLRRMTC NRESARRSRM QGKMKMERLK  60
TQVEQVMASN QFLSDKYVSL LELSHQILLE NSQLKKALSS FQEYYTTLCY GKRDDDHMPA  120
NINDFDLNLQ SLDQPY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10003688m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010491438.13e-48PREDICTED: bZIP transcription factor 2
TrEMBLR0FLV45e-97R0FLV4_9BRAS; Uncharacterized protein
STRINGXP_006290053.18e-98(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17031811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08141.13e-41basic leucine-zipper 75