PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10003197m
Common NameCARUB_v10003197mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 180aa    MW: 20093 Da    PI: 10.3427
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10003197mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.81.2e-0878123550
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      k+ +r + NR++A++sR +K+ ++e L +k+ eLe e + L+ +le
  Carubv10003197m  78 KKLKRVIANRVSAQKSRWKKLLYVEALVKKSMELERETSVLRAQLE 123
                      899**************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.7E-971132No hitNo description
SMARTSM003382.4E-574145IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.23276139IPR004827Basic-leucine zipper domain
PfamPF077162.7E-776123IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.0E-878132No hitNo description
CDDcd147033.65E-1479130No hitNo description
PROSITE patternPS0003608196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MSFPVAATSF RVPQSGGQGG VPQSGSQAEV SQSGSQSGGS QSGSSQEGEK KAPYVQYEVE  60
PGFTIRMRHN IDPAMDPKKL KRVIANRVSA QKSRWKKLLY VEALVKKSME LERETSVLRA  120
QLEIAIQEKR RLQIEQRQLK ETLAARFQDC IDEKGIIEFY KVEIERLKKK NMAPPTNPT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10003197m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286756.11e-129basic leucine zipper 6
TrEMBLR0GRZ21e-127R0GRZ2_9BRAS; Uncharacterized protein
STRINGXP_006286756.11e-128(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144181821
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.17e-59bZIP family protein