PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001554m
Common NameCARUB_v10001361mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 306aa    MW: 34647.1 Da    PI: 7.0647
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001554mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.69.7e-125487336
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvk 36
                     ++k +rr+++NReAAr+sR+RKka++++Le+   
  Carubv10001554m 54 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSRL 87
                     6899*************************98544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-552112IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.6345496IPR004827Basic-leucine zipper domain
PfamPF001704.1E-95485IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-75690No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-75884No hitNo description
PROSITE patternPS0003605974IPR004827Basic-leucine zipper domain
PfamPF141441.7E-17149188IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MWEESFKNNG GLYTPGSIII PTNEKTDSLS EDTSHGAEGT PHKFDQEAST SRHPDKIQRR  60
LAQNREAARK SRLRKKAYVQ QLETSRLKLI HLEQELDRAR QQGFYVGNGV ESSALGFSDN  120
MSSGIVAFEM EYGHWVEEQN RQICELRTST AAKIDVFYVM SGMWKTSAER FFLWIGGFRP  180
SELLKVLLPH FDPLTDQQLL DVCNLKQSCQ QAEDALSQGM EKLQHTLAES VAAGRLGEGS  240
YTPQMTCAME RLEALADHLR HETLQQMHRI LTTRQAARGL LALGEYFQRL RALSSSWAAR  300
QREPT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10001554m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293510.0AK229351.1 Arabidopsis thaliana mRNA for bZip transcription factor OBF4 / AtbZip57, complete cds, clone: RAFL16-60-A10.
GenBankBT0248960.0BT024896.1 Arabidopsis thaliana At5g10030 mRNA, complete cds.
GenBankX698990.0X69899.1 A.thaliana OBF4 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023637287.10.0transcription factor TGA4 isoform X2
SwissprotQ391620.0TGA4_ARATH; Transcription factor TGA4
TrEMBLR0HBJ80.0R0HBJ8_9BRAS; Uncharacterized protein
STRINGXP_006288132.10.0(Capsella rubella)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.20.0TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]