PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001477m
Common NameCARUB_v10001361mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 320aa    MW: 36410.2 Da    PI: 7.1107
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001477mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.51e-1178110335
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekv 35 
                      ++k +rr+++NReAAr+sR+RKka++++Le+  
  Carubv10001477m  78 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSR 110
                      6899*************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-576136IPR004827Basic-leucine zipper domain
PfamPF001704.4E-978109IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.63478120IPR004827Basic-leucine zipper domain
CDDcd147084.34E-2180131No hitNo description
SuperFamilySSF579591.63E-780114No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-781121No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
PfamPF141442.6E-30166241IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MNTTSTHFVP QRRFETYEPL NQIGMWEESF KNNGGLYTPG SIIIPTNEKT DSLSEDTSHG  60
AEGTPHKFDQ EASTSRHPDK IQRRLAQNRE AARKSRLRKK AYVQQLETSR LKLIHLEQEL  120
DRARQQGFYV GNGVESSALG FSDNMSSGIV AFEMEYGHWV EEQNRQICEL RTVLHGHVSD  180
IELRSLVENA MKHYFQLFRM KSTAAKIDVF YVMSGMWKTS AERFFLWIGG FRPSELLKVL  240
LPHFDPLTDQ QLLDVCNLKQ SCQQAEDALS QGMEKLQHTL AESVAAGRLG EGSYTPQMTC  300
AMERLEALVS FVNQVRKKA*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10001477m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293510.0AK229351.1 Arabidopsis thaliana mRNA for bZip transcription factor OBF4 / AtbZip57, complete cds, clone: RAFL16-60-A10.
GenBankBT0248960.0BT024896.1 Arabidopsis thaliana At5g10030 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023637284.10.0transcription factor TGA4 isoform X1
RefseqXP_023637285.10.0transcription factor TGA4 isoform X1
RefseqXP_023637286.10.0transcription factor TGA4 isoform X1
SwissprotQ391620.0TGA4_ARATH; Transcription factor TGA4
TrEMBLR0GVW90.0R0GVW9_9BRAS; Uncharacterized protein
STRINGCagra.1085s0054.1.p0.0(Capsella grandiflora)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.20.0TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]