PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001471m
Common NameCARUB_v10001471mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 321aa    MW: 35328.2 Da    PI: 6.1742
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001471mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_159.85.8e-19163214354
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                      +lkr rr+++NRe+ArrsR+RK++++  Le  v++L++eN++L k+l   ++
  Carubv10001471m 163 DLKRIRRMYSNRESARRSRRRKQEYLVDLESQVDSLKGENSTLYKQLIDATQ 214
                      79*****************************************988765555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.9E-14156216No hitNo description
SMARTSM003382.4E-16161225IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.07163209IPR004827Basic-leucine zipper domain
PfamPF001706.6E-16163209IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.07E-13164214No hitNo description
PROSITE patternPS000360168183IPR004827Basic-leucine zipper domain
PfamPF124984.1E-5232309IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSQLTLPLPS FPTNFSSSCV FIYQKKMDGH TAKDMGMKRS ASELALQEYV TKFLSSSALS  60
RQESILLDTI PLDPSFDLIN RDYTSELRDS LLWSDCLIPT GNFRDAQSSI CENLSADSPV  120
SANKPEARGG ARRTTSGSSH DHSDEEDAET EAGQSEMTND PNDLKRIRRM YSNRESARRS  180
RRRKQEYLVD LESQVDSLKG ENSTLYKQLI DATQQFRSAG TNNRVLKSDV ETLRVKVKLA  240
EDLVARGSLT SSLNQLLQTH LSPPSHSINS LHYTGNTSPA VRVHSDQSLF PGMTLSGQTS  300
SPGLGNVSSE AVSCVSDIWP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177184RRSRRRKQ
2179184SRRRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10001471m
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by glucose. {ECO:0000269|PubMed:18841482}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3102230.0AF310223.1 Arabidopsis thaliana bZIP protein BZO2H2 mRNA, complete cds.
GenBankAK2268730.0AK226873.1 Arabidopsis thaliana mRNA for bZIP protein BZO2H2, clone: RAFL09-07-B02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288231.10.0basic leucine zipper 9
SwissprotQ9FUD30.0BZIP9_ARATH; Basic leucine zipper 9
TrEMBLR0GW390.0R0GW39_9BRAS; Uncharacterized protein
STRINGXP_006288231.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-147basic leucine zipper 9
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ortiz-EspĂ­n A, et al.
    Mitochondrial AtTrxo1 is transcriptionally regulated by AtbZIP9 and AtAZF2 and affects seed germination under saline conditions.
    J. Exp. Bot., 2017. 68(5): p. 1025-1038
    [PMID:28184497]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]